| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Bcl-2-related protein A1 |
|---|
| Ligand | BDBM34194 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2249566 (CHEMBL5163776) |
|---|
| Ki | 400±n/a nM |
|---|
| Citation |  Feng, X; Yan, Z; Zhou, F; Lou, J; Lyu, X; Ren, X; Zeng, Z; Liu, C; Zhang, S; Zhu, D; Huang, H; Yang, J; Zhao, Y Discovery of a selective and covalent small-molecule inhibitor of BFL-1 protein that induces robust apoptosis in cancer cells. Eur J Med Chem236:0 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Bcl-2-related protein A1 |
|---|
| Name: | Bcl-2-related protein A1 |
|---|
| Synonyms: | B2LA1_HUMAN | BCL2A1 | BCL2L5 | BFL1 | Bcl-2-like protein 5 | GRS | HBPA1 | Hemopoietic-specific early response protein | Protein BFL-1 | Protein GRS |
|---|
| Type: | Apoptosis regulator protein |
|---|
| Mol. Mass.: | 20130.01 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 175 |
|---|
| Sequence: | MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
|
|
|
|---|
| BDBM34194 |
|---|
| n/a |
|---|
| Name | BDBM34194 |
|---|
| Synonyms: | 3-chloranyl-1-(3,4-dichlorophenyl)-4-(4-methylpiperazin-1-yl)pyrrole-2,5-dione | 3-chloro-1-(3,4-dichlorophenyl)-4-(4-methyl-1-piperazinyl)pyrrole-2,5-dione | 3-chloro-1-(3,4-dichlorophenyl)-4-(4-methylpiperazin-1-yl)pyrrole-2,5-dione | 3-chloro-1-(3,4-dichlorophenyl)-4-(4-methylpiperazino)-3-pyrroline-2,5-quinone | MLS000110530 | PD119792 | SMR000106459 | cid_1180676 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C15H14Cl3N3O2 |
|---|
| Mol. Mass. | 374.65 |
|---|
| SMILES | CN1CCN(CC1)C1=C(Cl)C(=O)N(C1=O)c1ccc(Cl)c(Cl)c1 |c:8| |
|---|
| Structure | 
|
|---|
Search and Browse
