Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Bcl-2-related protein A1 |
---|
Ligand | BDBM50604880 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2249570 (CHEMBL5163780) |
---|
Ki | 1130±n/a nM |
---|
Citation | Feng, X; Yan, Z; Zhou, F; Lou, J; Lyu, X; Ren, X; Zeng, Z; Liu, C; Zhang, S; Zhu, D; Huang, H; Yang, J; Zhao, Y Discovery of a selective and covalent small-molecule inhibitor of BFL-1 protein that induces robust apoptosis in cancer cells. Eur J Med Chem236:0 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Bcl-2-related protein A1 |
---|
Name: | Bcl-2-related protein A1 |
Synonyms: | B2LA1_HUMAN | BCL2A1 | BCL2L5 | BFL1 | Bcl-2-like protein 5 | GRS | HBPA1 | Hemopoietic-specific early response protein | Protein BFL-1 | Protein GRS |
Type: | Apoptosis regulator protein |
Mol. Mass.: | 20130.01 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 175 |
Sequence: | MTDCEFGYIYRLAQDYLQCVLQIPQPGSGPSKTSRVLQNVAFSVQKEVEKNLKSCLDNVN
VVSVDTARTLFNQVMEKEFEDGIINWGRIVTIFAFEGILIKKLLRQQIAPDVDTYKEISY
FVAEFIMNNTGEWIRQNGGWENGFVKKFEPKSGWMTFLEVTGKICEMLSLLKQYC
|
|
|
BDBM50604880 |
---|
n/a |
---|
Name | BDBM50604880 |
Synonyms: | CHEMBL5191993 |
Type | Small organic molecule |
Emp. Form. | C23H25FN4O |
Mol. Mass. | 392.4692 |
SMILES | CCCn1nc2cc(ccc2c1N1CCN(CC1)C(=O)C=C)-c1cccc(F)c1 |
Structure |
|