Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | RAC-alpha serine/threonine-protein kinase |
---|
Ligand | BDBM50606346 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2254475 (CHEMBL5168685) |
---|
IC50 | 0.600000±n/a nM |
---|
Citation | Ma, C; Wu, J; Wang, L; Ji, X; Wu, Y; Miao, L; Chen, D; Zhang, L; Wu, Y; Feng, H; Tang, Y; Zhou, Q; Pei, J; Yang, X; Xu, D; You, Q; Xie, Y Discovery of Clinical Candidate NTQ1062 as a Potent and Bioavailable Akt Inhibitor for the Treatment of Human Tumors. J Med Chem65:8144-8168 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
RAC-alpha serine/threonine-protein kinase |
---|
Name: | RAC-alpha serine/threonine-protein kinase |
Synonyms: | AKT phosphorylation (p-AKT) | AKT1 | AKT1/PPP1CA | AKT1_HUMAN | C-AKT | PKB | PKB alpha | Protein kinase Akt-1 | Protein kinase B | Protein kinase B (AKT1) | Protein kinase B (Akt 1) | Protein kinase B (Akt) | Protein kinase B alpha | Protein kinase B alpha (AKT1) | Proto-oncogene Akt (Akt1) | Proto-oncogene c-Akt (AKT) | Proto-oncogene c-Akt (AKT1) | RAC | RAC-PK-alpha | RAC-alpha serine/threonine-protein kinase (AKT) | RAC-alpha serine/threonine-protein kinase (AKT1) | RAC-alpha serine/threonine-protein kinase (pAKT) |
Type: | Enzyme |
Mol. Mass.: | 55681.25 |
Organism: | Homo sapiens (Human) |
Description: | P31749 |
Residue: | 480 |
Sequence: | MSDVAIVKEGWLHKRGEYIKTWRPRYFLLKNDGTFIGYKERPQDVDQREAPLNNFSVAQC
QLMKTERPRPNTFIIRCLQWTTVIERTFHVETPEEREEWTTAIQTVADGLKKQEEEEMDF
RSGSPSDNSGAEEMEVSLAKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKI
LKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLS
RERVFSEDRARFYGAEIVSALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGI
KDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFEL
ILMEEIRFPRTLGPEAKSLLSGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKK
LSPPFKPQVTSETDTRYFDEEFTAQMITITPPDQDDSMECVDSERRPHFPQFSYSASGTA
|
|
|
BDBM50606346 |
---|
n/a |
---|
Name | BDBM50606346 |
Synonyms: | CHEMBL5197007 | US20230321108, Isomer 4 of Example 3 |
Type | Small organic molecule |
Emp. Form. | C24H29ClN6O3 |
Mol. Mass. | 484.978 |
SMILES | [H][C@@]12C[C@]1([H])N(CCN2C(=O)[C@H](CNC(C)C)c1ccc(Cl)cc1)c1ncnc2NC(=O)O[C@@H](C)c12 |r| |
Structure |
|