Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Nicotinamide N-methyltransferase |
---|
Ligand | BDBM50607541 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_2262932 (CHEMBL5217943) |
---|
IC50 | 102±n/a nM |
---|
Citation | Barrows, RD; Jeffries, DE; Vishe, M; Tukachinsky, H; Zheng, SL; Li, F; Ma, Z; Li, X; Jin, S; Song, H; Zhang, R; Zhang, S; Ni, J; Luan, H; Wen, L; Rongshan, Y; Ying, C; Shair, MD Potent Uncompetitive Inhibitors of Nicotinamide J Med Chem65:14642-14654 (2022) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Nicotinamide N-methyltransferase |
---|
Name: | Nicotinamide N-methyltransferase |
Synonyms: | NNMT | NNMT_HUMAN | Nicotinamide N-methyltransferase | Nicotinamide N-methyltransferase (NNMT) |
Type: | Protein |
Mol. Mass.: | 29571.16 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 264 |
Sequence: | MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLI
DIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGN
RVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRAL
RNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQ
SYSSTMANNEGLFSLVARKLSRPL
|
|
|
BDBM50607541 |
---|
n/a |
---|
Name | BDBM50607541 |
Synonyms: | CHEMBL5221106 |
Type | Small organic molecule |
Emp. Form. | C9H11N3O |
Mol. Mass. | 177.2031 |
SMILES | Cc1c2CCNc2ncc1C(N)=O |
Structure |
|