| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Nicotinamide N-methyltransferase |
|---|
| Ligand | BDBM50607542 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_2262932 (CHEMBL5217943) |
|---|
| IC50 | 92±n/a nM |
|---|
| Citation |  Barrows, RD; Jeffries, DE; Vishe, M; Tukachinsky, H; Zheng, SL; Li, F; Ma, Z; Li, X; Jin, S; Song, H; Zhang, R; Zhang, S; Ni, J; Luan, H; Wen, L; Rongshan, Y; Ying, C; Shair, MD Potent Uncompetitive Inhibitors of Nicotinamide J Med Chem65:14642-14654 (2022) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Nicotinamide N-methyltransferase |
|---|
| Name: | Nicotinamide N-methyltransferase |
|---|
| Synonyms: | NNMT | NNMT_HUMAN | Nicotinamide N-methyltransferase | Nicotinamide N-methyltransferase (NNMT) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 29571.16 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | n/a |
|---|
| Residue: | 264 |
|---|
| Sequence: | MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLI
DIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGN
RVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRAL
RNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQ
SYSSTMANNEGLFSLVARKLSRPL
|
|
|
|---|
| BDBM50607542 |
|---|
| n/a |
|---|
| Name | BDBM50607542 |
|---|
| Synonyms: | CHEMBL5219823 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C8H8ClN3O |
|---|
| Mol. Mass. | 197.622 |
|---|
| SMILES | NC(=O)c1cnc2NCCc2c1Cl |
|---|
| Structure | 
|
|---|
Search and Browse
