| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin D2 receptor 2 |
|---|
| Ligand | BDBM50213907 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_456177 (CHEMBL888187) |
|---|
| Ki | 99±n/a nM |
|---|
| Citation |  Sandham, DA; Aldcroft, C; Baettig, U; Barker, L; Beer, D; Bhalay, G; Brown, Z; Dubois, G; Budd, D; Bidlake, L; Campbell, E; Cox, B; Everatt, B; Harrison, D; Leblanc, CJ; Manini, J; Profit, R; Stringer, R; Thompson, KS; Turner, KL; Tweed, MF; Walker, C; Watson, SJ; Whitebread, S; Willis, J; Williams, G; Wilson, C 2-Cycloalkyl phenoxyacetic acid CRTh2 receptor antagonists. Bioorg Med Chem Lett17:4347-50 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin D2 receptor 2 |
|---|
| Name: | Prostaglandin D2 receptor 2 |
|---|
| Synonyms: | CD_antigen=CD294 | CRTH2 | Chemoattractant Receptor-homologous molecule expressed on T-helper type 2 cells (CRTH2) | Chemoattractant receptor-homologous molecule expressed on Th2 cells | Chemoattractant receptor-homologous molecule expressed on Th2 cells (CRTH2) | DL1R | G protein-coupled receptor 44 | G-protein coupled receptor 44 | GPR44 | PD2R2_HUMAN | PTGDR2 | Prostaglandin D2 | Prostaglandin D2 receptor 2 | Prostaglandin D2 receptor 2 (PGD2) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 43295.45 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q9Y5Y4 |
|---|
| Residue: | 395 |
|---|
| Sequence: | MSANATLKPLCPILEQMSRLQSHSNTSIRYIDHAAVLLHGLASLLGLVENGVILFVVGCR
MRQTVVTTWVLHLALSDLLASASLPFFTYFLAVGHSWELGTTFCKLHSSIFFLNMFASGF
LLSAISLDRCLQVVRPVWAQNHRTVAAAHKVCLVLWALAVLNTVPYFVFRDTISRLDGRI
MCYYNVLLLNPGPDRDATCNSRQVALAVSKFLLAFLVPLAIIASSHAAVSLRLQHRGRRR
PGRFVRLVAAVVAAFALCWGPYHVFSLLEARAHANPGLRPLVWRGLPFVTSLAFFNSVAN
PVLYVLTCPDMLRKLRRSLRTVLESVLVDDSELGGAGSSRRRRTSSTARSASPLALCSRP
EEPRGPARLLGWLLGSCAASPQTGPLNRALSSTSS
|
|
|
|---|
| BDBM50213907 |
|---|
| n/a |
|---|
| Name | BDBM50213907 |
|---|
| Synonyms: | (3-cyclohexyl-4'-fluoro-biphenyl-4-yloxy)-acetic acid | CHEMBL429470 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C20H21FO3 |
|---|
| Mol. Mass. | 328.3773 |
|---|
| SMILES | OC(=O)COc1ccc(cc1C1CCCCC1)-c1ccc(F)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
