| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Gag-Pol polyprotein [489-587] |
|---|
| Ligand | BDBM50283364 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEBML_79925 |
|---|
| IC50 | 2±n/a nM |
|---|
| Citation |  Schirlin, D; Dorsselaer, VV; Tarnus, C; Taylor, DL; Tyms, AS; Baltzer, S; Weber, F; Remy, JM; Brennan, T; Farr, R; Janowick, D Beneficial replacement of the P1 phenylalanine side chain in HIV-1 protease inhibitors of the difluorostatone type Bioorg Med Chem Lett4:241-246 (1994) Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Gag-Pol polyprotein [489-587] |
|---|
| Name: | Gag-Pol polyprotein [489-587] |
|---|
| Synonyms: | Human immunodeficiency virus type 1 protease | POL_HV1H2 | Pol polyprotein | gag-pol |
|---|
| Type: | Enzyme Subunit |
|---|
| Mol. Mass.: | 10781.16 |
|---|
| Organism: | Human immunodeficiency virus type 1 |
|---|
| Description: | P04585[489-587] |
|---|
| Residue: | 99 |
|---|
| Sequence: | PQVTLWQRPLVTIKIGGQLKEALLDTGADDTVLEEMSLPGRWKPKMIGGIGGFIKVRQYD
QILIEICGHKAIGTVLVGPTPVNIIGRNLLTQIGCTLNF
|
|
|
|---|
| BDBM50283364 |
|---|
| n/a |
|---|
| Name | BDBM50283364 |
|---|
| Synonyms: | CHEMBL314234 | {(S)-1-[1-(4-Benzyloxy-benzyl)-4-(3,4-dihydro-1H-isoquinolin-2-yl)-3,3-difluoro-2,4-dioxo-butylcarbamoyl]-2-methyl-propyl}-carbamic acid benzyl ester |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C40H41F2N3O6 |
|---|
| Mol. Mass. | 697.7668 |
|---|
| SMILES | CC(C)[C@H](NC(=O)OCc1ccccc1)C(=O)NC(Cc1ccc(OCc2ccccc2)cc1)C(=O)C(F)(F)C(=O)N1CCc2ccccc2C1 |
|---|
| Structure | 
|
|---|
Search and Browse
