| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Ligand | BDBM50297381 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_583354 (CHEMBL1053347) |
|---|
| IC50 | 2.1±n/a nM |
|---|
| Citation |  Hutchinson, JH; Li, Y; Arruda, JM; Baccei, C; Bain, G; Chapman, C; Correa, L; Darlington, J; King, CD; Lee, C; Lorrain, D; Prodanovich, P; Rong, H; Santini, A; Stock, N; Prasit, P; Evans, JF 5-lipoxygenase-activating protein inhibitors: development of 3-[3-tert-butylsulfanyl-1-[4-(6-methoxy-pyridin-3-yl)-benzyl]-5-(pyridin-2-ylmethoxy)-1H-indol-2-yl]-2,2-dimethyl-propionic acid (AM103). J Med Chem52:5803-15 (2009) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Arachidonate 5-lipoxygenase-activating protein |
|---|
| Name: | Arachidonate 5-lipoxygenase-activating protein |
|---|
| Synonyms: | 5-lipoxygenase activating protein | 5-lipoxygenase-activating protein (FLAP) | 5-lipoxygenase/FLAP | AL5AP_HUMAN | ALOX5AP | FLAP | MK-886-binding protein |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 18159.90 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P20292 |
|---|
| Residue: | 161 |
|---|
| Sequence: | MDQETVGNVVLLAIVTLISVVQNGFFAHKVEHESRTQNGRSFQRTGTLAFERVYTANQNC
VDAYPTFLAVLWSAGLLCSQVPAAFAGLMYLFVRQKYFVGYLGERTQSTPGYIFGKRIIL
FLFLMSVAGIFNYYLIFFFGSDFENYIKTISTTISPLLLIP
|
|
|
|---|
| BDBM50297381 |
|---|
| n/a |
|---|
| Name | BDBM50297381 |
|---|
| Synonyms: | 3-(3-(tert-butylthio)-1-(4-(5-fluorothiazol-2-yl)benzyl)-5-(pyridin-2-ylmethoxy)-1H-indol-2-yl)-2,2-dimethylpropanoic acid | CHEMBL552545 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C33H34FN3O3S2 |
|---|
| Mol. Mass. | 603.77 |
|---|
| SMILES | CC(C)(C)Sc1c(CC(C)(C)C(O)=O)n(Cc2ccc(cc2)-c2ncc(F)s2)c2ccc(OCc3ccccn3)cc12 |
|---|
| Structure | 
|
|---|
Search and Browse
