| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Lactoylglutathione lyase |
|---|
| Ligand | BDBM50059989 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_716548 (CHEMBL1670272) |
|---|
| Ki | 18000±n/a nM |
|---|
| Citation |  Yuan, M; Luo, M; Song, Y; Xu, Q; Wang, X; Cao, Y; Bu, X; Ren, Y; Hu, X Identification of curcumin derivatives as human glyoxalase I inhibitors: A combination of biological evaluation, molecular docking, 3D-QSAR and molecular dynamics simulation studies. Bioorg Med Chem19:1189-96 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Lactoylglutathione lyase |
|---|
| Name: | Lactoylglutathione lyase |
|---|
| Synonyms: | Aldoketomutase | GLO1 | Glx I | Glyoxalase 1 (GLO1) | Glyoxalase I | Ketone-aldehyde mutase | LGUL_HUMAN | Methylglyoxalase | S-D-lactoylglutathione methylglyoxal lyase |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 20772.95 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q04760 |
|---|
| Residue: | 184 |
|---|
| Sequence: | MAEPQPPSGGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLIQK
CDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTEDDETQSYHNGNS
DPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKMKGLAFIQDPDGYWIEILNPNKM
ATLM
|
|
|
|---|
| BDBM50059989 |
|---|
| n/a |
|---|
| Name | BDBM50059989 |
|---|
| Synonyms: | (1E,4Z,6E)-5-Hydroxy-1,7-bis-(4-hydroxy-phenyl)-hepta-1,4,6-trien-3-one | (1E,6E)-1,7-Bis-(4-hydroxy-phenyl)-hepta-1,6-diene-3,5-dione | 1,7-bis(4-hydroxyphenyl)-1,6-heptadiene-3,5-dione | 1,7-bis(4-hydroxyphenyl)-3-hydroxy-1,3,6-heptatrien-5-one | 5-Hydroxy-1,7-bis(4-hydroxyphenyl)hepta-1,4,6-trien-3-one | 5-Hydroxy-1,7-bis-(4-hydroxy-phenyl)-hepta-1,4,6-trien-3-one | CHEMBL105350 | CHEMBL131770 | bis-demethoxycurcumin | cid_5324473 | curcumin III |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C19H16O4 |
|---|
| Mol. Mass. | 308.3279 |
|---|
| SMILES | Oc1ccc(C=CC(=O)CC(=O)C=Cc2ccc(O)cc2)cc1 |w:12.11,5.4| |
|---|
| Structure | 
|
|---|
Search and Browse
