Reaction Details |
| Report a problem with these data |
Target | P2Y purinoceptor 14 |
---|
Ligand | BDBM50343095 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_745158 (CHEMBL1772337) |
---|
IC50 | 25±n/a nM |
---|
Citation | Guay, D; Beaulieu, C; Belley, M; Crane, SN; DeLuca, J; Gareau, Y; Hamel, M; Henault, M; Hyjazie, H; Kargman, S; Chan, CC; Xu, L; Gordon, R; Li, L; Mamane, Y; Morin, N; Mancini, J; Thérien, M; Tranmer, G; Truong, VL; Wang, Z; Black, WC Synthesis and SAR of pyrimidine-based, non-nucleotide P2Y14 receptor antagonists. Bioorg Med Chem Lett21:2832-5 (2011) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
P2Y purinoceptor 14 |
---|
Name: | P2Y purinoceptor 14 |
Synonyms: | G-protein coupled receptor 105 | Gpr105 | P2Y14 | P2Y14_MOUSE | P2ry14 | UDP-glucose receptor |
Type: | PROTEIN |
Mol. Mass.: | 38883.93 |
Organism: | Mus musculus |
Description: | ChEMBL_745158 |
Residue: | 338 |
Sequence: | MNNSTTTDPPNQPCSWNTLITKQIIPVLYGMVFITGLLLNGISGWIFFYVPSSKSFIIYL
KNIVVADFLMGLTFPFKVLGDSGLGPWQVNVFVCRVSAVIFYVNMYVSIVFFGLISFDRY
YKIVKPLLTSIVQSVNYSKLLSVLVWMLMLLLAVPNIILTNQGVKEVTKIQCMELKNELG
RKWHKASNYIFVSIFWVVFLLLIVFYTAITRKIFKSHLKSRKNSTSVKRKSSRNIFSIVL
VFVVCFVPYHIARIPYTKSQTEGHYSCRTKETLLYAKEFTLLLSAANVCLDPIIYFFLCQ
PFREVLNKKLHMSLKVQNDLEVSKTKRENAIHESTDTL
|
|
|
BDBM50343095 |
---|
n/a |
---|
Name | BDBM50343095 |
Synonyms: | CHEMBL1771452 | N-(3-ethylphenyl)-2-(4-fluorophenyl)-4-o-tolyl-7,8-dihydropyrido[4,3-d]pyrimidine-6(5H)-carboxamide |
Type | Small organic molecule |
Emp. Form. | C29H27FN4O |
Mol. Mass. | 466.5493 |
SMILES | CCc1cccc(NC(=O)N2CCc3nc(nc(c3C2)-c2ccccc2C)-c2ccc(F)cc2)c1 |
Structure |
|