Reaction Details |
| Report a problem with these data |
Target | Substance-P receptor |
---|
Ligand | BDBM50279775 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_205883 (CHEMBL872713) |
---|
Ki | 0.12±n/a nM |
---|
Citation | Albert, JS; Aharony, D; Andisik, D; Barthlow, H; Bernstein, PR; Bialecki, RA; Dedinas, R; Dembofsky, BT; Hill, D; Kirkland, K; Koether, GM; Kosmider, BJ; Ohnmacht, C; Palmer, W; Potts, W; Rumsey, W; Shen, L; Shenvi, A; Sherwood, S; Warwick, PJ; Russell, K Design, synthesis, and SAR of tachykinin antagonists: modulation of balance in NK(1)/NK(2) receptor antagonist activity. J Med Chem45:3972-83 (2002) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Substance-P receptor |
---|
Name: | Substance-P receptor |
Synonyms: | NK-1 receptor | NK-1R | NK1 Receptor | NK1R | NK1R_HUMAN | Neurokinin 1 receptor | Neurokinin-1 (NK-1) | Neuromedin-1 receptor (NK-1R) | SPR | TAC1R | TACR1 | Tachykinin receptor 1 | Tachykinin receptor 1 (NK1) | tachykinin |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 46254.43 |
Organism: | Homo sapiens (Human) |
Description: | P25103 |
Residue: | 407 |
Sequence: | MDNVLPVDSDLSPNISTNTSEPNQFVQPAWQIVLWAAAYTVIVVTSVVGNVVVMWIILAH
KRMRTVTNYFLVNLAFAEASMAAFNTVVNFTYAVHNEWYYGLFYCKFHNFFPIAAVFASI
YSMTAVAFDRYMAIIHPLQPRLSATATKVVICVIWVLALLLAFPQGYYSTTETMPSRVVC
MIEWPEHPNKIYEKVYHICVTVLIYFLPLLVIGYAYTVVGITLWASEIPGDSSDRYHEQV
SAKRKVVKMMIVVVCTFAICWLPFHIFFLLPYINPDLYLKKFIQQVYLAIMWLAMSSTMY
NPIIYCCLNDRFRLGFKHAFRCCPFISAGDYEGLEMKSTRYLQTQGSVYKVSRLETTIST
VVGAHEEEPEDGPKATPSSLDLTSNCSSRSDSKTMTESFSFSSNVLS
|
|
|
BDBM50279775 |
---|
n/a |
---|
Name | BDBM50279775 |
Synonyms: | (S)-3-Cyano-naphthalene-1-carboxylic acid {2-(3,4-dichloro-phenyl)-4-[4-(2-methanesulfinyl-phenyl)-piperidin-1-yl]-butyl}-methyl-amide | 3-Cyano-naphthalene-1-carboxylic acid ((S)-2-(3,4-dichloro-phenyl)-4-{4-[2-((S)-methanesulfinyl)-phenyl]-piperidin-1-yl}-butyl)-methyl-amide | CHEMBL129683 |
Type | Small organic molecule |
Emp. Form. | C35H35Cl2N3O2S |
Mol. Mass. | 632.642 |
SMILES | CN(C[C@@H](CCN1CCC(CC1)c1ccccc1[S@](C)=O)c1ccc(Cl)c(Cl)c1)C(=O)c1cc(cc2ccccc12)C#N |
Structure |
|