Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Methionine aminopeptidase |
---|
Ligand | BDBM50129662 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_105132 (CHEMBL872687) |
---|
IC50 | 2100±n/a nM |
---|
Citation | Luo, QL; Li, JY; Liu, ZY; Chen, LL; Li, J; Qian, Z; Shen, Q; Li, Y; Lushington, GH; Ye, QZ; Nan, FJ Discovery and structural modification of inhibitors of methionine aminopeptidases from Escherichia coli and Saccharomyces cerevisiae. J Med Chem46:2631-40 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Methionine aminopeptidase |
---|
Name: | Methionine aminopeptidase |
Synonyms: | EcMetAP | MAP1_ECOLI | Methionine Aminopeptidase (MAP) | Methionine aminopeptidase | Peptidase M | map |
Type: | Enzyme |
Mol. Mass.: | 29326.96 |
Organism: | Escherichia coli (strain K12) |
Description: | Full-length untagged EcMAP was expressed in E. coli. |
Residue: | 264 |
Sequence: | MAISIKTPEDIEKMRVAGRLAAEVLEMIEPYVKPGVSTGELDRICNDYIVNEQHAVSACL
GYHGYPKSVCISINEVVCHGIPDDAKLLKDGDIVNIDVTVIKDGFHGDTSKMFIVGKPTI
MGERLCRITQESLYLALRMVKPGINLREIGAAIQKFVEAEGFSVVREYCGHGIGRGFHEE
PQVLHYDSRETNVVLKPGMTFTIEPMVNAGKKEIRTMKDGWTVKTKDRSLSAQYEHTIVV
TDNGCEILTLRKDDTIPAIISHDE
|
|
|
BDBM50129662 |
---|
n/a |
---|
Name | BDBM50129662 |
Synonyms: | 3-(2-Methoxy-phenyl)-acrylic acid 2-(thiazol-2-ylcarbamoyl)-pyridin-3-yl ester | CHEMBL89269 |
Type | Small organic molecule |
Emp. Form. | C19H15N3O4S |
Mol. Mass. | 381.405 |
SMILES | COc1ccccc1\C=C\C(=O)Oc1cccnc1C(=O)Nc1nccs1 |
Structure |
|