Reaction Details |
| Report a problem with these data |
Target | Integrase |
---|
Ligand | BDBM50076182 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1473839 (CHEMBL3418916) |
---|
IC50 | >21000±n/a nM |
---|
Citation | Cuzzucoli Crucitti, G; Métifiot, M; Pescatori, L; Messore, A; Madia, VN; Pupo, G; Saccoliti, F; Scipione, L; Tortorella, S; Esposito, F; Corona, A; Cadeddu, M; Marchand, C; Pommier, Y; Tramontano, E; Costi, R; Di Santo, R Structure-activity relationship of pyrrolyl diketo acid derivatives as dual inhibitors of HIV-1 integrase and reverse transcriptase ribonuclease H domain. J Med Chem58:1915-28 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Integrase |
---|
Name: | Integrase |
Synonyms: | pol |
Type: | PROTEIN |
Mol. Mass.: | 32203.43 |
Organism: | Human immunodeficiency virus 1 |
Description: | ChEMBL_106649 |
Residue: | 288 |
Sequence: | FLDGIDKAQEEHEKYHSNWRAMASDFNLPPVVAKEIVASCDKCQLKGEAMHGQVDCSPGI
WQLDCTHLEGKVILVAVHVASGYIEAEVIPAETGQETAYFLLKLAGRWPVKTVHTDNGSN
FTSTTVKAACWWAGIKQEFGIPYNPQSQGVIESMNKELKKIIGQVRDQAEHLKTAVQMAV
FIHNFKRKGGIGGYSAGERIVDIIATDIQTKELQKQITKIQNFRVYYRDSRDPVWKGPAK
LLWKGEGAVVIQDNSDIKVVPRRKAKIIRDYGKQMAGDDCVASRQDED
|
|
|
BDBM50076182 |
---|
n/a |
---|
Name | BDBM50076182 |
Synonyms: | CHEMBL3415840 |
Type | Small organic molecule |
Emp. Form. | C25H22FNO4 |
Mol. Mass. | 419.4449 |
SMILES | CCOC(=O)C(\O)=C\C(=O)\C=C\c1cn(Cc2ccc(F)cc2)cc1-c1ccccc1 |
Structure |
|