Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Nociceptin receptor |
---|
Ligand | BDBM50101089 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1452449 (CHEMBL3362473) |
---|
Ki | 5.4±n/a nM |
---|
Citation | Schunk, S; Linz, K; Frormann, S; Hinze, C; Oberbörsch, S; Sundermann, B; Zemolka, S; Englberger, W; Germann, T; Christoph, T; Kögel, BY; Schröder, W; Harlfinger, S; Saunders, D; Kless, A; Schick, H; Sonnenschein, H Discovery of Spiro[cyclohexane-dihydropyrano[3,4-b]indole]-amines as Potent NOP and Opioid Receptor Agonists. ACS Med Chem Lett5:851-6 (2014) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Nociceptin receptor |
---|
Name: | Nociceptin receptor |
Synonyms: | KOR-3 | Kappa-type 3 opioid receptor | Mu-type opioid receptor (Mu) | NOP | Nociceptin Receptor (ORL1 Receptor) | Nociceptin receptor (NOP) | Nociceptin receptor (ORL-1) | Nociceptin receptor (ORL1) | Nociceptin/Orphanin FQ, NOP receptor | OOR | OPIATE ORL-1 | OPRL1 | OPRL1 protein | OPRX_HUMAN | ORL1 | ORL1 receptor | Opioid receptor like-1 | Orphanin FQ receptor | Orphanin FQ receptor (ORL1) | P41146 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40702.87 |
Organism: | Homo sapiens (Human) |
Description: | P41146 |
Residue: | 370 |
Sequence: | MEPLFPAPFWEVIYGSHLQGNLSLLSPNHSLLPPHLLLNASHGAFLPLGLKVTIVGLYLA
VCVGGLLGNCLVMYVILRHTKMKTATNIYIFNLALADTLVLLTLPFQGTDILLGFWPFGN
ALCKTVIAIDYYNMFTSTFTLTAMSVDRYVAICHPIRALDVRTSSKAQAVNVAIWALASV
VGVPVAIMGSAQVEDEEIECLVEIPTPQDYWGPVFAICIFLFSFIVPVLVISVCYSLMIR
RLRGVRLLSGSREKDRNLRRITRLVLVVVAVFVGCWTPVQVFVLAQGLGVQPSSETAVAI
LRFCTALGYVNSCLNPILYAFLDENFKACFRKFCCASALRRDVQVSDRVRSIAKDVALAC
KTSETVPRPA
|
|
|
BDBM50101089 |
---|
n/a |
---|
Name | BDBM50101089 |
Synonyms: | CHEMBL3326221 |
Type | Small organic molecule |
Emp. Form. | C23H29N3 |
Mol. Mass. | 347.4965 |
SMILES | n/a |
Structure |
|