Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Prostaglandin D2 receptor |
---|
Ligand | BDBM50103402 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1463663 (CHEMBL3399050) |
---|
EC50 | 61±n/a nM |
---|
Citation | Tran, TA; Shin, YJ; Kramer, B; Choi, J; Zou, N; Vallar, P; Martens, P; Boatman, PD; Adams, JW; Ramirez, J; Shi, Y; Morgan, M; Unett, DJ; Chang, S; Shu, HH; Tung, SF; Semple, G Discovery of a new series of potent prostacyclin receptor agonists with in vivo activity in rat. Bioorg Med Chem Lett25:1030-5 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Prostaglandin D2 receptor |
---|
Name: | Prostaglandin D2 receptor |
Synonyms: | PD2R_HUMAN | PTGDR | Prostaglandin D2 | Prostaglandin D2 receptor | Prostanoid DP receptor |
Type: | Enzyme |
Mol. Mass.: | 40288.87 |
Organism: | Homo sapiens (Human) |
Description: | Q13258 |
Residue: | 359 |
Sequence: | MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
|
|
|
BDBM50103402 |
---|
n/a |
---|
Name | BDBM50103402 |
Synonyms: | CHEMBL3398211 |
Type | Small organic molecule |
Emp. Form. | C29H25ClN2O4 |
Mol. Mass. | 500.973 |
SMILES | OC(=O)COc1cccc2CC(Cn3nc(-c4ccccc4)c(cc3=O)-c3cccc(Cl)c3)CCc12 |
Structure |
|