| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanin-concentrating hormone receptor 1 |
|---|
| Ligand | BDBM50107746 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1509310 (CHEMBL3603123) |
|---|
| Ki | 4.0±n/a nM |
|---|
| Citation |  Müller, SG; Heckel, A; Kley, JT; Lehmann, T; Lustenberger, P; Oost, T; Roth, GJ; Rudolf, K; Arndt, K; Lenter, M; Lotz, RR; Maier, GM; Markert, M; Schindler, M; Stenkamp, D Design, synthesis and evaluation of MCH receptor 1 antagonists--Part I: Optimization of HTS hits towards an in vivo efficacious tool compound BI 414. Bioorg Med Chem Lett25:3264-9 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanin-concentrating hormone receptor 1 |
|---|
| Name: | Melanin-concentrating hormone receptor 1 |
|---|
| Synonyms: | G-protein coupled receptor 24 | Gpr24 | MCH receptor 1 | MCH-1R | MCH-R1 | MCH1R | MCHR | MCHR-1 | MCHR1_RAT | Mchr1 | Melanin Concentrating Hormone 1 | Melanin-concentrating hormone receptor | Melanin-concentrating hormone receptor 1 | SLC-1 | Slc1 | Somatostatin receptor-like protein |
|---|
| Type: | Enzyme Catalytic Domain |
|---|
| Mol. Mass.: | 39075.64 |
|---|
| Organism: | RAT |
|---|
| Description: | Melanin Concentrating Hormone 1 GPR24 RAT::P97639 |
|---|
| Residue: | 353 |
|---|
| Sequence: | MDLQTSLLSTGPNASNISDGQDNLTLPGSPPRTGSVSYINIIMPSVFGTICLLGIVGNST
VIFAVVKKSKLHWCSNVPDIFIINLSVVDLLFLLGMPFMIHQLMGNGVWHFGETMCTLIT
AMDANSQFTSTYILTAMTIDRYLATVHPISSTKFRKPSMATLVICLLWALSFISITPVWL
YARLIPFPGGAVGCGIRLPNPDTDLYWFTLYQFFLAFALPFVVITAAYVKILQRMTSSVA
PASQRSIRLRTKRVTRTAIAICLVFFVCWAPYYVLQLTQLSISRPTLTFVYLYNAAISLG
YANSCLNPFVYIVLCETFRKRLVLSVKPAAQGQLRTVSNAQTADEERTESKGT
|
|
|
|---|
| BDBM50107746 |
|---|
| n/a |
|---|
| Name | BDBM50107746 |
|---|
| Synonyms: | CHEMBL3600828 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C25H23ClN2O |
|---|
| Mol. Mass. | 402.916 |
|---|
| SMILES | Clc1ccc(cc1)-c1ccc(nc1)C#Cc1ccc(OCCN2CCCC2)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
