| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Sphingosine 1-phosphate receptor 3 |
|---|
| Ligand | BDBM50156677 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1570718 (CHEMBL3795086) |
|---|
| EC50 | 1900±n/a nM |
|---|
| Citation |  Guo, J; Watterson, SH; Spergel, SH; Kempson, J; Langevine, CM; Shen, DR; Yarde, M; Cvijic, ME; Banas, D; Liu, R; Suchard, SJ; Gillooly, K; Taylor, T; Rex-Rabe, S; Shuster, DJ; McIntyre, KW; Cornelius, G; D'Arienzo, C; Marino, A; Balimane, P; Salter-Cid, L; McKinnon, M; Barrish, JC; Carter, PH; Pitts, WJ; Xie, J; Dyckman, AJ Identification and synthesis of potent and selective pyridyl-isoxazole based agonists of sphingosine-1-phosphate 1 (S1P1). Bioorg Med Chem Lett26:2470-4 (2016) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Sphingosine 1-phosphate receptor 3 |
|---|
| Name: | Sphingosine 1-phosphate receptor 3 |
|---|
| Synonyms: | C9orf108 | C9orf47 | EDG3 | Endothelial differentiation G-protein coupled receptor 3 | S1P receptor 3 | S1P receptor Edg-3 | S1P3 | S1PR3 | S1PR3_HUMAN | Sphingosine 1-phosphate receptor | Sphingosine 1-phosphate receptor 3 (S1P3) | Sphingosine 1-phosphate receptor Edg-3 |
|---|
| Type: | G Protein-Coupled Receptor (GPCR) |
|---|
| Mol. Mass.: | 42278.13 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q99500 |
|---|
| Residue: | 378 |
|---|
| Sequence: | MATALPPRLQPVRGNETLREHYQYVGKLAGRLKEASEGSTLTTVLFLVICSFIVLENLMV
LIAIWKNNKFHNRMYFFIGNLALCDLLAGIAYKVNILMSGKKTFSLSPTVWFLREGSMFV
ALGASTCSLLAIAIERHLTMIKMRPYDANKRHRVFLLIGMCWLIAFTLGALPILGWNCLH
NLPDCSTILPLYSKKYIAFCISIFTAILVTIVILYARIYFLVKSSSRKVANHNNSERSMA
LLRTVVIVVSVFIACWSPLFILFLIDVACRVQACPILFKAQWFIVLAVLNSAMNPVIYTL
ASKEMRRAFFRLVCNCLVRGRGARASPIQPALDPSRSKSSSSNNSSHSPKVKEDLPHTAP
SSCIMDKNAALQNGIFCN
|
|
|
|---|
| BDBM50156677 |
|---|
| n/a |
|---|
| Name | BDBM50156677 |
|---|
| Synonyms: | CHEMBL3792704 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H21N5O4 |
|---|
| Mol. Mass. | 431.4439 |
|---|
| SMILES | CCc1c(noc1-c1ccccn1)-c1nc(no1)-c1ccc(CN2CC(C2)C(O)=O)cc1 |
|---|
| Structure | 
|
|---|
Search and Browse
