Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Similar to alpha-tubulin isoform 1 |
---|
Ligand | BDBM50230727 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_211322 (CHEMBL818981) |
---|
IC50 | >167000±n/a nM |
---|
Citation | Terada, T; Fujimoto, K; Nomura, M; Yamashita, J; Wierzba, K; Yamazaki, R; Shibata, J; Sugimoto, Y; Yamada, Y; Kobunai, T Antitumor agents. 3. Synthesis and biological activity of 4 beta-alkyl derivatives containing hydroxy, amino, and amido groups of 4'-O-demethyl-4-desoxypodophyllotoxin as antitumor agents. J Med Chem36:1689-99 (1993) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Similar to alpha-tubulin isoform 1 |
---|
Name: | Similar to alpha-tubulin isoform 1 |
Synonyms: | Similar to alpha-tubulin isoform 1 |
Type: | PROTEIN |
Mol. Mass.: | 10383.05 |
Organism: | Bos taurus |
Description: | ChEMBL_104716 |
Residue: | 99 |
Sequence: | CVSASPSTLARLVSRSAMPAGSSTAWNTAFSPMARCQVTKTIGGGDDSFNTFFSETGAGK
HVPRAVFVDLEPTVIDEVRTGTYRSSSTLSSSSQAKKMP
|
|
|
BDBM50230727 |
---|
n/a |
---|
Name | BDBM50230727 |
Synonyms: | CHEMBL552576 |
Type | Small organic molecule |
Emp. Form. | C30H40ClNO7 |
Mol. Mass. | 562.094 |
SMILES | Cl.[H][C@@]12C(COC1=O)[C@H](CCN(C)CCCCCC)c1cc3OCOc3cc1[C@H]2c1cc(OC)c(O)c(OC)c1 |r| |
Structure |
|