Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | VIM-24 |
---|
Ligand | BDBM153698 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Direct Competition Assay |
---|
Ki | 6.0e+3± 7e+2 nM |
---|
Citation | Mojica, MF; Mahler, SG; Bethel, CR; Taracila, MA; Kosmopoulou, M; Papp-Wallace, KM; Llarrull, LI; Wilson, BM; Marshall, SH; Wallace, CJ; Villegas, MV; Harris, ME; Vila, AJ; Spencer, J; Bonomo, RA Exploring the Role of Residue 228 in Substrate and Inhibitor Recognition by VIM Metallo-ß-lactamases. Biochemistry54:3183-96 (2015) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
VIM-24 |
---|
Name: | VIM-24 |
Synonyms: | Metallo-beta-lactamase VIM-24 (VIM-24) |
Type: | Protein |
Mol. Mass.: | 28273.97 |
Organism: | Klebsiella pneumoniae (Enterobacteria) |
Description: | E0AFT6 |
Residue: | 266 |
Sequence: | MFKLLSKLLVYLTASIMAIASPLAFSVDSSGEYPTVSEIPVGEVRLYQIADGVWSHIATQ
SFDGAVYPSNGLIVRDGDELLLIDTAWGAKNTAALLAEIEKQIGLPVTRAVSTHFHDDRV
GGVDVLRAAGVATYASPSTRRLAEVEGNEIPTHSLEGLSSSGDAVRFGPVELFYPGAAHS
TDNLVVYVPSASVLYGGCAIYELSLTSAGNVADADLAEWPTSIERIQQHYPEAQFVIPGH
GLPGGLDLLKHTTNVVKAHTNRSVVE
|
|
|
BDBM153698 |
---|
n/a |
---|
Name | BDBM153698 |
Synonyms: | L-CS319 |
Type | Small organic molecule |
Emp. Form. | C7H11NO2S3 |
Mol. Mass. | 237.363 |
SMILES | OC(=O)[C@@H]1CS[C@H]2CS[C@H](CS)N12 |r| |
Structure |
|