Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Adenosine receptor A1 |
---|
Ligand | BDBM21173 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | A1 Adenosine Receptor Binding Assay |
---|
pH | 7.4±n/a |
---|
Temperature | 298.15±n/a K |
---|
Kd | 3±n/a nM |
---|
Comments | extracted |
---|
Citation | Cosimelli, B; Greco, G; Laneri, S; Novellino, E; Sacchi, A; Trincavelli, ML; Giacomelli, C; Taliani, S; Da Settimo, F; Martini, C 4-amino-6-alkyloxy-2-alkylthiopyrimidine derivatives as novel non-nucleoside agonists for the adenosine A1 receptor. Chem Biol Drug Des88:724-729 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Adenosine receptor A1 |
---|
Name: | Adenosine receptor A1 |
Synonyms: | A1 adenosine receptor (hA1) | A1AR | AA1R_HUMAN | ADENOSINE A1 | ADORA1 | Adenosine A1 receptor (A1AR) | Adenosine A1-receptor | Adenosine receptor A1 (A1) | Adenosine receptor A1 (hA1) | Adenosine transporter (AdT) |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 36520.92 |
Organism: | Homo sapiens (Human) |
Description: | P30542 |
Residue: | 326 |
Sequence: | MPPSISAFQAAYIGIEVLIALVSVPGNVLVIWAVKVNQALRDATFCFIVSLAVADVAVGA
LVIPLAILINIGPQTYFHTCLMVACPVLILTQSSILALLAIAVDRYLRVKIPLRYKMVVT
PRRAAVAIAGCWILSFVVGLTPMFGWNNLSAVERAWAANGSMGEPVIKCEFEKVISMEYM
VYFNFFVWVLPPLLLMVLIYLEVFYLIRKQLNKKVSASSGDPQKYYGKELKIAKSLALIL
FLFALSWLPLHILNCITLFCPSCHKPSILTYIAIFLTHGNSAMNPIVYAFRIQKFRVTFL
KIWNDHFRCQPAPPIDEDLPEERPDD
|
|
|
BDBM21173 |
---|
n/a |
---|
Name | BDBM21173 |
Synonyms: | 1,3-dipropyl-8-cyclopentylxanthine | 8-cyclopentyl-1,3-dipropyl-2,3,6,7-tetrahydro-1H-purine-2,6-dione | CHEMBL183 | DPCPX | PD116948 | [3H]DPCPX |
Type | radiolabeled ligand |
Emp. Form. | C16H24N4O2 |
Mol. Mass. | 304.3874 |
SMILES | CCCn1c2nc([nH]c2c(=O)n(CCC)c1=O)C1CCCC1 |
Structure |
|