Reaction Details |
| Report a problem with these data |
Target | Cathepsin D |
---|
Ligand | BDBM214961 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | In Vitro Enzymatic Cathepsin D FRET Assay |
---|
pH | 3.5±n/a |
---|
IC50 | >400000±n/a nM |
---|
Comments | extracted |
---|
Citation | Minatti, AE; Low, JD; Allen, JR; Chen, J; Chen, N; Cheng, Y; Judd, T; Liu, Q; Lopez, P; Qian, W; Rumfelt, S; Rzasa, RM; Tamayo, NA; Xue, Q; Yang, B; Zhong, W Perfluorinated 5,6-dihydro-4H-1,3-oxazin-2-amine compounds as beta-secretase inhibitors and methods of use US Patent US9296734 Publication Date 3/29/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Cathepsin D |
---|
Name: | Cathepsin D |
Synonyms: | CATD_HUMAN | CPSD | CTSD | Cathepsin D [Precursor] | Cathepsin D heavy chain | Cathepsin D light chain | Cathepsin D precursor |
Type: | Enzyme |
Mol. Mass.: | 44551.72 |
Organism: | Homo sapiens (Human) |
Description: | Human proCathepsin D (SwissProt accession number P07339) was expressed in Sf9 cells, purified, and autoactivated. |
Residue: | 412 |
Sequence: | MQPSSLLPLALCLLAAPASALVRIPLHKFTSIRRTMSEVGGSVEDLIAKGPVSKYSQAVP
AVTEGPIPEVLKNYMDAQYYGEIGIGTPPQCFTVVFDTGSSNLWVPSIHCKLLDIACWIH
HKYNSDKSSTYVKNGTSFDIHYGSGSLSGYLSQDTVSVPCQSASSASALGGVKVERQVFG
EATKQPGITFIAAKFDGILGMAYPRISVNNVLPVFDNLMQQKLVDQNIFSFYLSRDPDAQ
PGGELMLGGTDSKYYKGSLSYLNVTRKAYWQVHLDQVEVASGLTLCKEGCEAIVDTGTSL
MVGPVDEVRELQKAIGAVPLIQGEYMIPCEKVSTLPAITLKLGGKGYKLSPEDYTLKVSQ
AGKTLCLSGFMGMDIPPPSGPLWILGDVFIGRYYTVFDRDNNRVGFAEAARL
|
|
|
BDBM214961 |
---|
n/a |
---|
Name | BDBM214961 |
Synonyms: | US9296734, 155 |
Type | Small organic molecule |
Emp. Form. | C21H17F6N5O3 |
Mol. Mass. | 501.3818 |
SMILES | CC#CCOc1cnc(cn1)C(=O)Nc1cc(F)c(F)c(c1)[C@]1(CF)C[C@H](OC(N)=N1)C(F)(F)F |r,c:31| |
Structure |
|