Reaction Details |
| Report a problem with these data |
Target | Urokinase plasminogen activator surface receptor |
---|
Ligand | BDBM222394 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Fluorescence Polarization Assay |
---|
Ki | 33500±2200 nM |
---|
Citation | Liu, D; Xu, D; Liu, M; Knabe, WE; Yuan, C; Zhou, D; Huang, M; Meroueh, SO Small Molecules Engage Hot Spots through Cooperative Binding To Inhibit a Tight Protein-Protein Interaction. Biochemistry56:1768-1784 (2017) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Urokinase plasminogen activator surface receptor |
---|
Name: | Urokinase plasminogen activator surface receptor |
Synonyms: | CD_antigen=CD87 | MO3 | Monocyte activation antigen Mo3 | PLAUR | U-PAR | UPAR | UPAR_HUMAN | Urokinase plasminogen activator surface receptor | Urokinase receptor (uPAR) | Urokinase-type plasminogen activator/surface receptor |
Type: | Receptor |
Mol. Mass.: | 36979.14 |
Organism: | Homo sapiens (Human) |
Description: | Q03405 |
Residue: | 335 |
Sequence: | MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEL
ELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISC
GSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNG
FHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGP
MNQCLVATGTHEPKNQSYMVRGCATASMCQHAHLGDAFSMNHIDVSCCTKSGCNHPDLDV
QYRSGAAPQPGPAHLSLTITLLMTARLWGGTLLWT
|
|
|
BDBM222394 |
---|
n/a |
---|
Name | BDBM222394 |
Synonyms: | IPR-1154 (47) |
Type | Small organic molecule |
Emp. Form. | C25H18BrClFNO3 |
Mol. Mass. | 514.771 |
SMILES | COC1=C(C(N(C1=O)c1ccc(C)c(Br)c1)c1cccc(F)c1)C(=O)c1ccc(Cl)cc1 |t:2| |
Structure |
|