Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | C-X-C chemokine receptor type 2 |
---|
Ligand | BDBM236786 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | In Vitro Affinity Assay |
---|
Temperature | 310.15±n/a K |
---|
IC50 | 44±n/a nM |
---|
Comments | extracted |
---|
Citation | Musicki, B; Aubert, J; Boiteaux, J; Clary, L; Rossio, P; Schuppli-Nollet, M Disubstituted 3,4-diamino-3-cyclobutene-1,2-dione compounds for use in the treatment of chemokine-mediated diseases US Patent US9388149 Publication Date 7/12/2016 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
C-X-C chemokine receptor type 2 |
---|
Name: | C-X-C chemokine receptor type 2 |
Synonyms: | C-X-C chemokine receptor type 2 (CXCR-2) | C-X-C chemokine receptor type 2 (CXCR2) | CD_antigen=CD182 | CDw128b | CXCR-2 | CXCR2 | CXCR2_HUMAN | Chemokine receptor type 2 (CXCR2) | GRO/MGSA receptor | High affinity interleukin-8 receptor B | IL-8 receptor type 2 | IL-8R B | IL8RB | Interleukin-8 receptor B |
Type: | Protein |
Mol. Mass.: | 40767.88 |
Organism: | Homo sapiens (Human) |
Description: | P25025 |
Residue: | 360 |
Sequence: | MEDFNMESDSFEDFWKGEDLSNYSYSSTLPPFLLDAAPCEPESLEINKYFVVIIYALVFL
LSLLGNSLVMLVILYSRVGRSVTDVYLLNLALADLLFALTLPIWAASKVNGWIFGTFLCK
VVSLLKEVNFYSGILLLACISVDRYLAIVHATRTLTQKRYLVKFICLSIWGLSLLLALPV
LLFRRTVYSSNVSPACYEDMGNNTANWRMLLRILPQSFGFIVPLLIMLFCYGFTLRTLFK
AHMGQKHRAMRVIFAVVLIFLLCWLPYNLVLLADTLMRTQVIQETCERRNHIDRALDATE
ILGILHSCLNPLIYAFIGQKFRHGLLKILAIHGLISKDSLPKDSRPSFVGSSSGHTSTTL
|
|
|
BDBM236786 |
---|
n/a |
---|
Name | BDBM236786 |
Synonyms: | US9388149, 17 |
Type | Small organic molecule |
Emp. Form. | C20H23N3O4S |
Mol. Mass. | 401.479 |
SMILES | CN1C=CC=C(Nc2c(NC(C3CCCS3)c3ccc(C)o3)c(=O)c2=O)C1O |w:10.10,c:2,t:4| |
Structure |
|