Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Oxysterols receptor LXR-alpha [197-447] |
---|
Ligand | BDBM35092 |
---|
Substrate/Competitor | BDBM19993 |
---|
Meas. Tech. | LXRbeta Binding Assay (IC50) and LAFbeta Functional Assay (EC50) |
---|
IC50 | 36±n/a nM |
---|
Citation | Bernotas, RC; Kaufman, DH; Singhaus, RR; Ullrich, J; Unwalla, R; Quinet, E; Nambi, P; Wilhelmsson, A; Goos-Nilsson, A; Wrobel, J 4-(3-aryloxyaryl)quinoline alcohols are liver X receptor agonists. Bioorg Med Chem17:8086-92 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Oxysterols receptor LXR-alpha [197-447] |
---|
Name: | Oxysterols receptor LXR-alpha [197-447] |
Synonyms: | LXRA | Liver X Receptor alpha (LXR-alpha) | NR1H3 | NR1H3_HUMAN | Nuclear orphan receptor LXR-alpha | Nuclear receptor subfamily 1 group H member 3 | Oxysterols receptor LXR-alpha |
Type: | Receptor |
Mol. Mass.: | 28986.41 |
Organism: | Homo sapiens (Human) |
Description: | LXR alpha ligand binding domain (amino acid residues 197-447) with an N-terminal biotinylation tag expressed in E.coli, was used for the binding assays. |
Residue: | 251 |
Sequence: | SSPPQILPQLSPEQLGMIEKLVAAQQQCNRRSFSDRLRVTPWPMAPDPHSREARQQRFAH
FTELAIVSVQEIVDFAKQLPGFLQLSREDQIALLKTSAIEVMLLETSRRYNPGSESITFL
KDFSYNREDFAKAGLQVEFINPIFEFSRAMNELQLNDAEFALLIAISIFSADRPNVQDQL
QVERLQHTYVEALHAYVSIHHPHDRLMFPRMLMKLVSLRTLSSVHSEQVFALRLQDKKLP
PLLSEIWDVHE
|
|
|
BDBM35092 |
---|
BDBM19993 |
---|
Name | BDBM35092 |
Synonyms: | biarylether alcohol quinoline, 5e |
Type | Small organic molecule |
Emp. Form. | C28H20ClNO2 |
Mol. Mass. | 437.917 |
SMILES | OCc1ccc(Oc2cccc(c2)-c2c(cnc3c(Cl)cccc23)-c2ccccc2)cc1 |
Structure |
|