| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Alpha-1A adrenergic receptor |
|---|
| Ligand | BDBM50457833 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1760808 (CHEMBL4195816) |
|---|
| IC50 | 8000±n/a nM |
|---|
| Citation |  Bagal, SK; Andrews, M; Bechle, BM; Bian, J; Bilsland, J; Blakemore, DC; Braganza, JF; Bungay, PJ; Corbett, MS; Cronin, CN; Cui, JJ; Dias, R; Flanagan, NJ; Greasley, SE; Grimley, R; James, K; Johnson, E; Kitching, L; Kraus, ML; McAlpine, I; Nagata, A; Ninkovic, S; Omoto, K; Scales, S; Skerratt, SE; Sun, J; Tran-Dubé, M; Waldron, GJ; Wang, F; Warmus, JS Discovery of Potent, Selective, and Peripherally Restricted Pan-Trk Kinase Inhibitors for the Treatment of Pain. J Med Chem61:6779-6800 (2018) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Alpha-1A adrenergic receptor |
|---|
| Name: | Alpha-1A adrenergic receptor |
|---|
| Synonyms: | ADA1A_HUMAN | ADRA1A | ADRA1C | Adrenergic alpha1A | Alpha 1A-adrenoceptor | Alpha 1A-adrenoreceptor | Alpha adrenergic receptor 1a | Alpha-1C adrenergic receptor | Alpha-adrenergic receptor 1c | Cerebral cortex alpha adrenergic receptor | adrenergic Alpha1 | adrenergic Alpha1C |
|---|
| Type: | Cell-surface receptors |
|---|
| Mol. Mass.: | 51511.67 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P35348 |
|---|
| Residue: | 466 |
|---|
| Sequence: | MVFLSGNASDSSNCTQPPAPVNISKAILLGVILGGLILFGVLGNILVILSVACHRHLHSV
THYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGRVFCNIWAAVDVLCCTASIMGLCII
SIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLVISIGPLFGWRQPAPEDETICQINE
EPGYVLFSALGSFYLPLAIILVMYCRVYVVAKRESRGLKSGLKTDKSDSEQVTLRIHRKN
APAGGSGMASAKTKTHFSVRLLKFSREKKAAKTLGIVVGCFVLCWLPFFLVMPIGSFFPD
FKPSETVFKIVFWLGYLNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTL
HPPSQAVEGQHKDMVRIPVGSRETFYRISKTDGVCEWKFFSSMPRGSARITVSKDQSSCT
TARVRSKSFLQVCCCVGPSTPSLDKNHQVPTIKVHTISLSENGEEV
|
|
|
|---|
| BDBM50457833 |
|---|
| n/a |
|---|
| Name | BDBM50457833 |
|---|
| Synonyms: | CHEMBL4210892 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C24H23F4N5O4 |
|---|
| Mol. Mass. | 521.4641 |
|---|
| SMILES | Cn1cnc(c1)-c1cnc(O[C@H]2CCN(C[C@H]2F)C(=O)Cc2ccc(OC(F)(F)F)cc2)c(c1)C(N)=O |r| |
|---|
| Structure | 
|
|---|
Search and Browse
