Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Reverse transcriptase |
---|
Ligand | BDBM50479973 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_564789 (CHEMBL954255) |
---|
IC50 | 2.0±n/a nM |
---|
Citation | Piscitelli, F; Coluccia, A; Brancale, A; La Regina, G; Sansone, A; Giordano, C; Balzarini, J; Maga, G; Zanoli, S; Samuele, A; Cirilli, R; La Torre, F; Lavecchia, A; Novellino, E; Silvestri, R Indolylarylsulfones bearing natural and unnatural amino acids. Discovery of potent inhibitors of HIV-1 non-nucleoside wild type and resistant mutant strains reverse transcriptase and coxsackie B4 virus. J Med Chem52:1922-34 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase |
---|
Name: | Reverse transcriptase |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 29598.37 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WKE8 |
Residue: | 254 |
Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
BDBM50479973 |
---|
n/a |
---|
Name | BDBM50479973 |
Synonyms: | CHEMBL470630 |
Type | Small organic molecule |
Emp. Form. | C19H20BrN3O5S2 |
Mol. Mass. | 514.413 |
SMILES | Cc1cc(C)cc(c1)S(=O)(=O)c1c([nH]c2ccc(Br)cc12)C(=O)NCCS(N)(=O)=O |
Structure |
|