Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Reverse transcriptase |
---|
Ligand | BDBM50480227 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_545205 (CHEMBL1018956) |
---|
IC50 | 300±n/a nM |
---|
Citation | Spallarossa, A; Cesarini, S; Ranise, A; Schenone, S; Bruno, O; Borassi, A; La Colla, P; Pezzullo, M; Sanna, G; Collu, G; Secci, B; Loddo, R Parallel synthesis, molecular modelling and further structure-activity relationship studies of new acylthiocarbamates as potent non-nucleoside HIV-1 reverse transcriptase inhibitors. Eur J Med Chem44:2190-201 (2009) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Reverse transcriptase |
---|
Name: | Reverse transcriptase |
Synonyms: | n/a |
Type: | Protein |
Mol. Mass.: | 29598.37 |
Organism: | Human immunodeficiency virus 1 |
Description: | Q9WKE8 |
Residue: | 254 |
Sequence: | PISPITVPVKLKPGMDGPKVKQWPLTEEKIKALTEICTEMEKEGKIEKIGPENPYNTPVF
AIKKKDSTKWRKVVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLD
KDFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVIY
QYMDDLYVGSDLEIEQHRAKIEELRQHLLRWGFTTPDKKHQKEPPFLWMGYELHPDKWTV
QPIVLPEKDSWTVN
|
|
|
BDBM50480227 |
---|
n/a |
---|
Name | BDBM50480227 |
Synonyms: | CHEMBL520032 |
Type | Small organic molecule |
Emp. Form. | C25H18ClN3O6S |
Mol. Mass. | 523.945 |
SMILES | Cc1ccc2C(=O)N(CCOC(=S)N(C(=O)c3ccc(Cl)cc3)c3ccc(cc3)[N+]([O-])=O)C(=O)c2c1 |
Structure |
|