| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase protein |
|---|
| Ligand | BDBM50482991 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_675253 (CHEMBL1273235) |
|---|
| IC50 | 70±n/a nM |
|---|
| Citation |  Liu, B; Lee, Y; Zou, J; Petrassi, HM; Joseph, RW; Chao, W; Michelotti, EL; Bukhtiyarova, M; Springman, EB; Dorsey, BD Discovery and SAR of a series of 4,6-diamino-1,3,5-triazin-2-ol as novel non-nucleoside reverse transcriptase inhibitors of HIV-1. Bioorg Med Chem Lett20:6592-6 (2010) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase protein |
|---|
| Name: | Reverse transcriptase protein |
|---|
| Synonyms: | Reverse Transcriptase | Reverse Transcriptase (A62V) | Reverse Transcriptase (F61A) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 30203.56 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WJQ2 |
|---|
| Residue: | 259 |
|---|
| Sequence: | PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIVLPEKDSWTVNDIQK
|
|
|
|---|
| BDBM50482991 |
|---|
| n/a |
|---|
| Name | BDBM50482991 |
|---|
| Synonyms: | CHEMBL1270036 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C26H25N5O2 |
|---|
| Mol. Mass. | 439.509 |
|---|
| SMILES | CN(Cc1ccc2OCCc2c1)c1nc(O)nc(Nc2c(C)cccc2-c2ccccc2)n1 |
|---|
| Structure | 
|
|---|
Search and Browse
