| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Reverse transcriptase protein |
|---|
| Ligand | BDBM50483682 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_741509 (CHEMBL1769292) |
|---|
| IC50 | 170±n/a nM |
|---|
| Citation |  La Regina, G; Coluccia, A; Brancale, A; Piscitelli, F; Gatti, V; Maga, G; Samuele, A; Pannecouque, C; Schols, D; Balzarini, J; Novellino, E; Silvestri, R Indolylarylsulfones as HIV-1 non-nucleoside reverse transcriptase inhibitors: new cyclic substituents at indole-2-carboxamide. J Med Chem54:1587-98 (2011) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Reverse transcriptase protein |
|---|
| Name: | Reverse transcriptase protein |
|---|
| Synonyms: | Reverse Transcriptase | Reverse Transcriptase (A62V) | Reverse Transcriptase (F61A) |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 30203.56 |
|---|
| Organism: | Human immunodeficiency virus 1 |
|---|
| Description: | Q9WJQ2 |
|---|
| Residue: | 259 |
|---|
| Sequence: | PISPIEPVPVKLKPGMDGPKVKQWPLTEEKIKALVEICTEMEKEGKISKIGPENPYNTPV
FAIKKKDSTRWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKRSVTVLDVGDAYFSVPL
DKEFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFRKQNPDIVI
YQYMDDLYVGSDLEIGQHRTKIEELRQHLLKWGFTTPDKKHQKEPPFLWMGYEHHPDKWT
VQPIVLPEKDSWTVNDIQK
|
|
|
|---|
| BDBM50483682 |
|---|
| n/a |
|---|
| Name | BDBM50483682 |
|---|
| Synonyms: | CHEMBL1766240 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C23H21ClFN3O3S |
|---|
| Mol. Mass. | 473.948 |
|---|
| SMILES | Cc1cc(C)cc(c1)S(=O)(=O)c1c([nH]c2ccc(Cl)c(F)c12)C(=O)NCCn1cccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
