| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Serine protease 1 |
|---|
| Ligand | BDBM50077174 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_212508 (CHEMBL817573) |
|---|
| Ki | 760±n/a nM |
|---|
| Citation |  Phillips, G; Davey, DD; Eagen, KA; Koovakkat, SK; Liang, A; Ng, HP; Pinkerton, M; Trinh, L; Whitlow, M; Beatty, AM; Morrissey, MM Design, synthesis, and activity of 2,6-diphenoxypyridine-derived factor Xa inhibitors. J Med Chem42:1749-56 (1999) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Serine protease 1 |
|---|
| Name: | Serine protease 1 |
|---|
| Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 25790.52 |
|---|
| Organism: | Bos taurus (bovine) |
|---|
| Description: | P00760 |
|---|
| Residue: | 246 |
|---|
| Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
|---|
| BDBM50077174 |
|---|
| n/a |
|---|
| Name | BDBM50077174 |
|---|
| Synonyms: | 6-[6-(3-Carbamimidoyl-phenoxy)-5-oxo-1,2,5,6-tetrahydro-pyrazin-2-yloxy]-pyridine-2-carboxamidine | CHEMBL50961 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C17H17N7O3 |
|---|
| Mol. Mass. | 367.362 |
|---|
| SMILES | NC(=N)c1cccc(OC2N=C(CNC2=O)Oc2cccc(n2)C(N)=N)c1 |c:10| |
|---|
| Structure | 
|
|---|
Search and Browse
