Reaction Details |
| Report a problem with these data |
Target | Isoleucyl-tRNA synthetase |
---|
Ligand | BDBM50093005 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEBML_88824 |
---|
IC50 | 68.0±n/a nM |
---|
Citation | Banwell, MG; Crasto, CF; Easton, CJ; Forrest, AK; Karoli, T; March, DR; Mensah, L; Nairn, MR; O'Hanlon, PJ; Oldham, MD; Yue, W Analogues of SB-203207 as inhibitors of tRNA synthetases. Bioorg Med Chem Lett10:2263-6 (2001) [PubMed] |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Isoleucyl-tRNA synthetase |
---|
Name: | Isoleucyl-tRNA synthetase |
Synonyms: | n/a |
Type: | PROTEIN |
Mol. Mass.: | 5742.00 |
Organism: | Rattus norvegicus |
Description: | ChEMBL_88824 |
Residue: | 50 |
Sequence: | MQTSLGNFVTTTGISSTRTPRPRRESVYFDLIKLKIFHQITQENPGSRNI
|
|
|
BDBM50093005 |
---|
n/a |
---|
Name | BDBM50093005 |
Synonyms: | (4aR,6S,7R,7aS)-7-[2-((S)-2-Amino-4-methyl-pentanoylsulfamoyl)-acetylamino]-4-carbamoyl-6-hydroxy-2-methyl-2,4a,5,6,7,7a-hexahydro-1H-[2]pyrindine-7-carboxylic acid | CHEMBL421500 |
Type | Small organic molecule |
Emp. Form. | C19H31N5O8S |
Mol. Mass. | 489.543 |
SMILES | CC(C)C[C@H](N)C(=O)NS(=O)(=O)CC(=O)N[C@]1([C@@H](O)C[C@@H]2[C@H]1CN(C)C=C2C(N)=O)C(O)=O |c:26| |
Structure |
|