Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Growth hormone secretagogue receptor type 1 |
---|
Ligand | BDBM50539694 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_1978553 (CHEMBL4611688) |
---|
IC50 | >50000±n/a nM |
---|
Citation | Davidsson, Ö; Nilsson, K; Brånalt, J; Andersson, T; Berggren, K; Chen, Y; Fjellström, O; Gradén, H; Gustafsson, L; Hermansson, NO; Jansen, F; Johannesson, P; Ohlsson, B; Tyrchan, C; Wellner, A; Wellner, E; Ölwegård-Halvarsson, M Identification of novel GPR81 agonist lead series for target biology evaluation. Bioorg Med Chem Lett30:0 (2020) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Growth hormone secretagogue receptor type 1 |
---|
Name: | Growth hormone secretagogue receptor type 1 |
Synonyms: | GH-releasing peptide receptor | GHRP | GHS-R | GHSR | GHSR_HUMAN | Ghrelin Receptor (Growth Hormone Secretagogue Receptor Type 1) | Ghrelin receptor | Ghrelin receptor 1a (GHS-R1a) |
Type: | Receptor |
Mol. Mass.: | 41334.57 |
Organism: | Homo sapiens (Human) |
Description: | Receptor binding studies use plasma membranes from LLC PK-1 cells transiently transfected with hGHSR1a. |
Residue: | 366 |
Sequence: | MWNATPSEEPGFNLTLADLDWDASPGNDSLGDELLQLFPAPLLAGVTATCVALFVVGIAG
NLLTMLVVSRFRELRTTTNLYLSSMAFSDLLIFLCMPLDLVRLWQYRPWNFGDLLCKLFQ
FVSESCTYATVLTITALSVERYFAICFPLRAKVVVTKGRVKLVIFVIWAVAFCSAGPIFV
LVGVEHENGTDPWDTNECRPTEFAVRSGLLTVMVWVSSIFFFLPVFCLTVLYSLIGRKLW
RRRRGDAVVGASLRDQNHKQTVKMLAVVVFAFILCWLPFHVGRYLFSKSFEPGSLEIAQI
SQYCNLVSFVLFYLSAAINPILYNIMSKKYRVAVFRLLGFEPFSQRKLSTLKDESSRAWT
ESSINT
|
|
|
BDBM50539694 |
---|
n/a |
---|
Name | BDBM50539694 |
Synonyms: | CHEMBL4633635 |
Type | Small organic molecule |
Emp. Form. | C28H36ClN5O5S2 |
Mol. Mass. | 622.199 |
SMILES | CCOc1cc(Cl)c(cc1N1CCOCC1)C(=O)Nc1nc2ccc(cc2s1)S(=O)(=O)CCCN1CCN(C)CC1 |
Structure |
|