| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Melanocyte-stimulating hormone receptor |
|---|
| Ligand | BDBM50121885 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_322133 (CHEMBL885192) |
|---|
| EC50 | 10±n/a nM |
|---|
| Citation |  Chu, XJ; Bartkovitz, D; Danho, W; Swistok, J; Cheung, AW; Kurylko, G; Rowan, K; Yeon, M; Franco, L; Qi, L; Chen, L; Yagaloff, K Discovery of 1-amino-4-phenylcyclohexane-1-carboxylic acid and its influence on agonist selectivity between human melanocortin-4 and -1 receptors in linear pentapeptides. Bioorg Med Chem Lett15:4910-4 (2005) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Melanocyte-stimulating hormone receptor |
|---|
| Name: | Melanocyte-stimulating hormone receptor |
|---|
| Synonyms: | MC1-R | MC1R | MSH-R | MSHR | MSHR_HUMAN | Melanocortin MC1 | Melanocortin receptor (M1 and M4) | Melanocortin receptor 1 (MC-1) | Melanocortin receptor 1 (MC1-R) | Melanocortin receptor 1 (MC1R) |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 34717.23 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q01726 |
|---|
| Residue: | 317 |
|---|
| Sequence: | MAVQGSQRRLLGSLNSTPTAIPQLGLAANQTGARCLEVSISDGLFLSLGLVSLVENALVV
ATIAKNRNLHSPMYCFICCLALSDLLVSGSNVLETAVILLLEAGALVARAAVLQQLDNVI
DVITCSSMLSSLCFLGAIAVDRYISIFYALRYHSIVTLPRARRAVAAIWVASVVFSTLFI
AYYDHVAVLLCLVVFFLAMLVLMAVLYVHMLARACQHAQGIARLHKRQRPVHQGFGLKGA
VTLTILLGIFFLCWGPFFLHLTLIVLCPEHPTCGCIFKNFNLFLALIICNAIIDPLIYAF
HSQELRRTLKEVLTCSW
|
|
|
|---|
| BDBM50121885 |
|---|
| n/a |
|---|
| Name | BDBM50121885 |
|---|
| Synonyms: | (S)-2-{(R)-2-[(S)-2-Butyrylamino-3-(3H-imidazol-4-yl)-propionylamino]-3-phenyl-propionylamino}-5-guanidino-pentanoic acid [(S)-1-(carbamoylmethyl-carbamoyl)-2-(1H-indol-3-yl)-ethyl]-amide | Bu-His-DPhe-Arg-Trp-Gly-NH2 | CHEMBL29582 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C38H50N12O6 |
|---|
| Mol. Mass. | 770.8804 |
|---|
| SMILES | CCCC(=O)N[C@@H](Cc1cnc[nH]1)C(=O)N[C@H](Cc1ccccc1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](Cc1c[nH]c2ccccc12)C(=O)NCC(N)=O |
|---|
| Structure | 
|
|---|
Search and Browse
