Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Delta-type opioid receptor |
---|
Ligand | BDBM50422175 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | ChEMBL_146872 (CHEMBL857683) |
---|
IC50 | 140±n/a nM |
---|
Citation | Boteju, LW; Nikiforovich, GV; Haskell-Luevano, C; Fang, SN; Zalewska, T; Stropova, D; Yamamura, HI; Hruby, VJ The use of topographical constraints in receptor mapping: investigation of the topographical requirements of the tryptophan 30 residue for receptor binding of Asp-Tyr-D-Phe-Gly-Trp-(N-Me)Nle-Asp-Phe-NH2 (SNF 9007), a cholecystokinin (26-33) analogue that binds to both CCK-B and delta-opioid recepto J Med Chem39:4120-4 (1996) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Delta-type opioid receptor |
---|
Name: | Delta-type opioid receptor |
Synonyms: | D-OR-1 | DOR-1 | Delta opioid receptor | Delta-type opioid receptor (Delta) | OPIATE Delta | OPRD | OPRD1 | OPRD_HUMAN | OPRK1 | opioid receptor, delta 1 |
Type: | G Protein-Coupled Receptor (GPCR) |
Mol. Mass.: | 40382.98 |
Organism: | Homo sapiens (Human) |
Description: | Competition binding assays were carried out using membrane preparations from transfected HN9.10 cells that constitutively expressed the delta opioid receptor. |
Residue: | 372 |
Sequence: | MEPAPSAGAELQPPLFANASDAYPSACPSAGANASGPPGARSASSLALAIAITALYSAVC
AVGLLGNVLVMFGIVRYTKMKTATNIYIFNLALADALATSTLPFQSAKYLMETWPFGELL
CKAVLSIDYYNMFTSIFTLTMMSVDRYIAVCHPVKALDFRTPAKAKLINICIWVLASGVG
VPIMVMAVTRPRDGAVVCMLQFPSPSWYWDTVTKICVFLFAFVVPILIITVCYGLMLLRL
RSVRLLSGSKEKDRSLRRITRMVLVVVGAFVVCWAPIHIFVIVWTLVDIDRRDPLVVAAL
HLCIALGYANSSLNPVLYAFLDENFKRCFRQLCRKPCGRPDPSSFSRAREATARERVTAC
TPSDGPGGGAAA
|
|
|
BDBM50422175 |
---|
n/a |
---|
Name | BDBM50422175 |
Synonyms: | CHEMBL2112689 |
Type | Small organic molecule |
Emp. Form. | C56H68N10O13 |
Mol. Mass. | 1089.1983 |
SMILES | CCCC[C@H](N(C)C(=O)[C@@H](NC(=O)CNC(=O)[C@@H](Cc1ccccc1)NC(=O)[C@H](Cc1ccc(O)cc1)NC(=O)[C@@H](N)CC(O)=O)[C@@H](C)c1c[nH]c2ccccc12)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](Cc1ccccc1)C(N)=O |
Structure |
|