| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Peptide deformylase |
|---|
| Ligand | BDBM50089215 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_154575 (CHEMBL761923) |
|---|
| IC50 | 94±n/a nM |
|---|
| Citation |  Apfel, C; Banner, DW; Bur, D; Dietz, M; Hirata, T; Hubschwerlen, C; Locher, H; Page, MG; Pirson, W; Rossé, G; Specklin, JL Hydroxamic acid derivatives as potent peptide deformylase inhibitors and antibacterial agents. J Med Chem43:2324-31 (2000) [PubMed] |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Peptide deformylase |
|---|
| Name: | Peptide deformylase |
|---|
| Synonyms: | 3.5.1.88 | BON69_24600 | BON94_18585 | D9G11_24945 | D9G11_25760 | D9J60_20755 | FORC82_p394 | PDF | Polypeptide deformylase | SAMEA3472033_04733 | def | def_2 |
|---|
| Type: | n/a |
|---|
| Mol. Mass.: | 16901.39 |
|---|
| Organism: | Escherichia coli |
|---|
| Description: | n/a |
|---|
| Residue: | 150 |
|---|
| Sequence: | MSVLQVLHIPDERLRKVAKPVEEVNAEIQRIVDDMFETMYAEKGIGLAATQVDIHQRIIV
IDVSENRDERLVLINPELLEKSGETGIEEGCLSIPEQRALVPRAEKVKIRALDRDGKPFE
LEADGLLAICIGLRLGNGKYCTLRLFFNQV
|
|
|
|---|
| BDBM50089215 |
|---|
| n/a |
|---|
| Name | BDBM50089215 |
|---|
| Synonyms: | 3-(3-Methoxy-benzenesulfinyl)-heptanoic acid hydroxyamide | CHEMBL77578 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H21NO4S |
|---|
| Mol. Mass. | 299.386 |
|---|
| SMILES | CCCCC(CC(=O)NO)S(=O)c1cccc(OC)c1 |
|---|
| Structure | 
|
|---|
Search and Browse
