| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Cathepsin G |
|---|
| Ligand | BDBM19492 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_508158 (CHEMBL1008216) |
|---|
| IC50 | >50000±n/a nM |
|---|
| Citation |  Méthot, N; Rubin, J; Guay, D; Beaulieu, C; Ethier, D; Reddy, TJ; Riendeau, D; Percival, MD Inhibition of the activation of multiple serine proteases with a cathepsin C inhibitor requires sustained exposure to prevent pro-enzyme processing. J Biol Chem282:20836-46 (2007) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Cathepsin G |
|---|
| Name: | Cathepsin G |
|---|
| Synonyms: | CATG_MOUSE | Ctsg |
|---|
| Type: | PROTEIN |
|---|
| Mol. Mass.: | 29115.44 |
|---|
| Organism: | Mus musculus |
|---|
| Description: | ChEMBL_508158 |
|---|
| Residue: | 261 |
|---|
| Sequence: | MQPLLLLLTFILLQGDEAGKIIGGREARPHSYPYMAFLLIQSPEGLSACGGFLVREDFVL
TAAHCLGSSINVTLGAHNIQMRERTQQLITVLRAIRHPDYNPQNIRNDIMLLQLRRRARR
SGSVKPVALPQASKKLQPGDLCTVAGWGRVSQSRGTNVLQEVQLRVQMDQMCANRFQFYN
SQTQICVGNPRERKSAFRGDSGGPLVCSNVAQGIVSYGSNNGNPPAVFTKIQSFMPWIKR
TMRRFAPRYQRPANSLSQAQT
|
|
|
|---|
| BDBM19492 |
|---|
| n/a |
|---|
| Name | BDBM19492 |
|---|
| Synonyms: | (2R)-2-{[(1S)-1-(4-bromophenyl)-2,2,2-trifluoroethyl]amino}-N-(1-cyanocyclopropyl)-3-methanesulfonylpropanamide | CHEMBL400387 | trifluoroethylamine inhibitor, 2 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C16H17BrF3N3O3S |
|---|
| Mol. Mass. | 468.289 |
|---|
| SMILES | CS(=O)(=O)C[C@H](N[C@@H](c1ccc(Br)cc1)C(F)(F)F)C(=O)NC1(CC1)C#N |r| |
|---|
| Structure | 
|
|---|
Search and Browse
