| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Farnesyl pyrophosphate synthase |
|---|
| Ligand | BDBM12576 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1467358 (CHEMBL3411595) |
|---|
| IC50 | 11±n/a nM |
|---|
| Citation |  Gritzalis, D; Park, J; Chiu, W; Cho, H; Lin, YS; De Schutter, JW; Lacbay, CM; Zielinski, M; Berghuis, AM; Tsantrizos, YS Probing the molecular and structural elements of ligands binding to the active site versus an allosteric pocket of the human farnesyl pyrophosphate synthase. Bioorg Med Chem Lett25:1117-23 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Farnesyl pyrophosphate synthase |
|---|
| Name: | Farnesyl pyrophosphate synthase |
|---|
| Synonyms: | Dimethylallyltranstransferase | FDPS | FPP synthase | FPP synthetase | FPPS_HUMAN | FPS | Farnesyl diphosphate synthase | Farnesyl diphosphate synthase (FPPS) | Farnesyl diphosphate synthetase | Farnesyl pyrophosphate synthase (FPPS) | Farnesyl pyrophosphate synthetase | Geranyltranstransferase | KIAA1293 | P14324 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 48272.89 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | P14324 |
|---|
| Residue: | 419 |
|---|
| Sequence: | MPLSRWLRSVGVFLLPAPYWAPRERWLGSLRRPSLVHGYPVLAWHSARCWCQAWTEEPRA
LCSSLRMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAI
GGKYNRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRG
QICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLD
LLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLE
MGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKE
AEKVARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK
|
|
|
|---|
| BDBM12576 |
|---|
| n/a |
|---|
| Name | BDBM12576 |
|---|
| Synonyms: | Bisphosphonate 1 | CHEMBL923 | JMC515594 Compound 64 | RIS | Risdronate | US11279719, Example Risedronic acid RIS | [1-hydroxy-1-phosphono-2-(pyridin-3-yl)ethyl]phosphonic acid |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C7H11NO7P2 |
|---|
| Mol. Mass. | 283.1123 |
|---|
| SMILES | OC(Cc1cccnc1)(P(O)(O)=O)P(O)(O)=O |
|---|
| Structure | 
|
|---|
Search and Browse
