| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Prostaglandin D2 receptor |
|---|
| Ligand | BDBM50103396 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | ChEMBL_1462465 (CHEMBL3398868) |
|---|
| EC50 | 140±n/a nM |
|---|
| Citation |  Tran, TA; Shin, YJ; Kramer, B; Choi, J; Zou, N; Vallar, P; Martens, P; Boatman, PD; Adams, JW; Ramirez, J; Shi, Y; Morgan, M; Unett, DJ; Chang, S; Shu, HH; Tung, SF; Semple, G Discovery of a new series of potent prostacyclin receptor agonists with in vivo activity in rat. Bioorg Med Chem Lett25:1030-5 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Prostaglandin D2 receptor |
|---|
| Name: | Prostaglandin D2 receptor |
|---|
| Synonyms: | PD2R_HUMAN | PTGDR | Prostaglandin D2 | Prostaglandin D2 receptor | Prostanoid DP receptor |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 40288.87 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | Q13258 |
|---|
| Residue: | 359 |
|---|
| Sequence: | MKSPFYRCQNTTSVEKGNSAVMGGVLFSTGLLGNLLALGLLARSGLGWCSRRPLRPLPSV
FYMLVCGLTVTDLLGKCLLSPVVLAAYAQNRSLRVLAPALDNSLCQAFAFFMSFFGLSST
LQLLAMALECWLSLGHPFFYRRHITLRLGALVAPVVSAFSLAFCALPFMGFGKFVQYCPG
TWCFIQMVHEEGSLSVLGYSVLYSSLMALLVLATVLCNLGAMRNLYAMHRRLQRHPRSCT
RDCAEPRADGREASPQPLEELDHLLLLALMTVLFTMCSLPVIYRAYYGAFKDVKEKNRTS
EEAEDLRALRFLSVISIVDPWIFIIFRSPVFRIFFHKIFIRPLRYRSRCSNSTNMESSL
|
|
|
|---|
| BDBM50103396 |
|---|
| n/a |
|---|
| Name | BDBM50103396 |
|---|
| Synonyms: | CHEMBL3398236 |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C29H23F3N2O4 |
|---|
| Mol. Mass. | 520.4991 |
|---|
| SMILES | OC(=O)COc1cccc2C[C@H](Cn3ncc(-c4cccc(F)c4F)c(-c4ccc(F)cc4)c3=O)CCc12 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
