| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Uncharacterized protein YOR062C |
|---|
| Ligand | BDBM166696 |
|---|
| Substrate/Competitor | n/a |
|---|
| Meas. Tech. | Tyrosinase Inhibition Assay |
|---|
| pH | 6.8±n/a |
|---|
| IC50 | 7.45e+3± 3.1e+2 nM |
|---|
| Comments | extracted |
|---|
| Citation |  Xie, W; Zhang, J; Ma, X; Yang, W; Zhou, Y; Tang, X; Zou, Y; Li, H; He, J; Xie, S; Zhao, Y; Liu, F Synthesis and biological evaluation of kojic acid derivatives containing 1,2,4-triazole as potent tyrosinase inhibitors. Chem Biol Drug Des86:1087-92 (2015) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Assay Method |
|---|
| |
| Uncharacterized protein YOR062C |
|---|
| Name: | Uncharacterized protein YOR062C |
|---|
| Synonyms: | Tyrosinase | YO062_YEAST |
|---|
| Type: | Protein |
|---|
| Mol. Mass.: | 31886.70 |
|---|
| Organism: | Agaricus bisporus (Mushroom) |
|---|
| Description: | O00024 |
|---|
| Residue: | 268 |
|---|
| Sequence: | MTSLDDSVLTKKNIALLDNATNYIRPAIDYFHFKFNYDSLDVSTTWRLLLKMRKHKLLRL
PSCSSENEFDYSIYMARLYHCIWRRWSIKHFNLDEYKIDPLSINWNKEIDVTVLYGPDLV
GIHEREQPTPTDFPMGNIKEQGKQLLDVRKEGSASSLLKKGSVFYSKGKWLSQRSISFDD
TVRRRDIDKRGRFRESCVLINDVEQFQNYSIVWDESRHRYRRQALPDTYDYEHLYPNGDE
TPRNTPHDNIIIHQNLHSITEGSYIYIK
|
|
|
|---|
| BDBM166696 |
|---|
| n/a |
|---|
| Name | BDBM166696 |
|---|
| Synonyms: | 5-phenyl-3-[5-hydroxy-4-pyrone-2-yl-methylmercapto]-4-amino-1,2,4-triazole (6d) |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C14H12N4O3S |
|---|
| Mol. Mass. | 316.335 |
|---|
| SMILES | Nn1c(SCc2cc(=O)c(O)co2)nnc1-c1ccccc1 |
|---|
| Structure | 
|
|---|
Search and Browse
