Reaction Details |
![](/images/Email.png) | Report a problem with these data |
Target | Complement factor B [470-764] |
---|
Ligand | BDBM203868 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Human FB Proteolysis Assay (ELISA C3a) |
---|
pH | 7.4±n/a |
---|
Temperature | 277.15±n/a K |
---|
IC50 | >1.00e+5±n/a nM |
---|
Comments | extracted |
---|
Citation | Maibaum, J; Liao, SM; Vulpetti, A; Ostermann, N; Randl, S; Rüdisser, S; Lorthiois, E; Erbel, P; Kinzel, B; Kolb, FA; Barbieri, S; Wagner, J; Durand, C; Fettis, K; Dussauge, S; Hughes, N; Delgado, O; Hommel, U; Gould, T; Mac Sweeney, A; Gerhartz, B; Cumin, F; Flohr, S; Schubart, A; Jaffee, B; Harrison, R; Risitano, AM; Eder, J; Anderson, K Small-molecule factor D inhibitors targeting the alternative complement pathway. Nat Chem Biol12:1105-1110 (2016) [PubMed] Article |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Complement factor B [470-764] |
---|
Name: | Complement factor B [470-764] |
Synonyms: | BF | BFD | CFAB_HUMAN | CFB | Complement factor B (FB) catalytic domain |
Type: | Protein |
Mol. Mass.: | 33371.42 |
Organism: | Homo sapiens (Human) |
Description: | P00751 (470-764 aa) |
Residue: | 295 |
Sequence: | DESQSLSLCGMVWEHRKGTDYHKQPWQAKISVIRPSKGHESCMGAVVSEYFVLTAAHCFT
VDDKEHSIKVSVGGEKRDLEIEVVLFHPNYNINGKKEAGIPEFYDYDVALIKLKNKLKYG
QTIRPICLPCTEGTTRALRLPPTTTCQQQKEELLPAQDIKALFVSEEEKKLTRKEVYIKN
GDKKGSCERDAQYAPGYDKVKDISEVVTPRFLCTGGVSPYADPNTCRGDSGGPLIVHKRS
RFIQVGVISWGVVDVCKNQKRQKQVPAHARDFHINLFQVLPWLKEKLQDEDLGFL
|
|
|
BDBM203868 |
---|
n/a |
---|
Name | BDBM203868 |
Synonyms: | (S)-N2-benzhydryl-N1-(1-methyl-1H-indol-3-yl)pyrrolidine-1,2-dicarboxamide (5) |
Type | Small organic molecule |
Emp. Form. | C28H28N4O2 |
Mol. Mass. | 452.5475 |
SMILES | Cn1cc(NC(=O)N2CCC[C@H]2C(=O)NC(c2ccccc2)c2ccccc2)c2ccccc12 |r| |
Structure |
|