Reaction Details |
| Report a problem with these data |
Target | Induced myeloid leukemia cell differentiation protein Mcl-1 |
---|
Ligand | BDBM333146 |
---|
Substrate/Competitor | n/a |
---|
Meas. Tech. | Biochemical binding TR-FRET assay |
---|
IC50 | 67.0±n/a nM |
---|
Citation | Hird, A; Belmonte, M; Yang, W; Secrist, P; Robbins, D; Kazmirski, S; Wu, D; Peng, B; Johannes, J; Lamb, M; Ye, Q; Zheng, X MCL-1 inhibitors and methods of use thereof US Patent US10196404 Publication Date 2/5/2019 |
---|
More Info.: | Get all data from this article, Assay Method |
---|
|
Induced myeloid leukemia cell differentiation protein Mcl-1 |
---|
Name: | Induced myeloid leukemia cell differentiation protein Mcl-1 |
Synonyms: | BCL2L3 | Bcl-2-like protein 3 | Bcl-2-like protein 3 (Mcl-1) | Bcl-2-related protein EAT/mcl1 | Bcl2-L-3 | Induced myeloid leukemia cell differentiation protein (Mcl-1) | MCL1 | MCL1_HUMAN | Mcl-1 | Myeloid Cell factor-1 (Mcl-1) | Myeloid cell leukemia sequence 1 (BCL2-related) | mcl1/EAT |
Type: | Membrane; Single-pass membrane protein |
Mol. Mass.: | 37332.87 |
Organism: | Homo sapiens (Human) |
Description: | Q07820 |
Residue: | 350 |
Sequence: | MFGLKRNAVIGLNLYCGGAGLGAGSGGATRPGGRLLATEKEASARREIGGGEAGAVIGGS
AGASPPSTLTPDSRRVARPPPIGAEVPDVTATPARLLFFAPTRRAAPLEEMEAPAADAIM
SPEEELDGYEPEPLGKRPAVLPLLELVGESGNNTSTDGSLPSTPPPAEEEEDELYRQSLE
IISRYLREQATGAKDTKPMGRSGATSRKALETLRRVGDGVQRNHETAFQGMLRKLDIKNE
DDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQESCIEPLAESITDVLVR
TKRDWLVKQRGWDGFVEFFHVEDLEGGIRNVLLAFAGVAGVGAGLAYLIR
|
|
|
BDBM333146 |
---|
n/a |
---|
Name | BDBM333146 |
Synonyms: | Compound I | US10196404, Example 1 | US10196404, Example 2 | US10196404, Example 3 | US11472816, Example 3 | US11691989, Compound AZD5991 |
Type | Small organic molecule |
Emp. Form. | C35H34ClN5O3S2 |
Mol. Mass. | 672.259 |
SMILES | Cc1c-2c(CSCc3cc(CSc4cc(OCCCc5c(C(O)=O)n(C)c6c-2c(Cl)ccc56)c2ccccc2c4)n(C)n3)nn1C |
Structure |
|