| Reaction Details |
|---|
 | Report a problem with these data |
| Target | Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
|---|
| Ligand | BDBM13475 |
|---|
| Substrate/Competitor | BDBM13466 |
|---|
| Meas. Tech. | Phosphatase Inhibition Assay |
|---|
| pH | 7±n/a |
|---|
| Temperature | 295.15±n/a K |
|---|
| IC50 | 59±n/a nM |
|---|
| Citation |  Ala, PJ; Gonneville, L; Hillman, M; Becker-Pasha, M; Yue, EW; Douty, B; Wayland, B; Polam, P; Crawley, ML; McLaughlin, E; Sparks, RB; Glass, B; Takvorian, A; Combs, AP; Burn, TC; Hollis, GF; Wynn, R Structural insights into the design of nonpeptidic isothiazolidinone-containing inhibitors of protein-tyrosine phosphatase 1B. J Biol Chem281:38013-21 (2006) [PubMed] Article |
|---|
| More Info.: | Get all data from this article, Inhibition_Run data, Solution Info, Assay Method |
|---|
| |
| Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
|---|
| Name: | Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
|---|
| Synonyms: | PTN1_HUMAN | PTP-1B | PTP1B | PTPN1 | PTPase 1B | Protein-Tyrosine Phosphatase 1B (PTP1B) | Tyrosine-protein phosphatase, non-receptor type 1 |
|---|
| Type: | Enzyme |
|---|
| Mol. Mass.: | 34670.65 |
|---|
| Organism: | Homo sapiens (Human) |
|---|
| Description: | The catalytic domain of PTP 1B (residues 1-298) was expressed and purified from E. coli. |
|---|
| Residue: | 298 |
|---|
| Sequence: | MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHED
|
|
|
|---|
| BDBM13475 |
|---|
| BDBM13466 |
|---|
| Name | BDBM13475 |
|---|
| Synonyms: | Isothiazolidinone (IZD) deriv. 4 | N-[(1S)-1-(1H-1,3-benzodiazol-2-yl)-2-{4-[(5S)-1,1,3-trioxo-1,2-thiazolidin-5-yl]phenyl}ethyl]-4-methyl-3,4-dihydro-2H-1,4-benzoxazine-7-sulfonamide | N-[(1S)-1-(1H-benzoimidazol-2-yl)-2-[4-[(5S)-1,1,3-trioxo-1,2-thiazolidin-5-yl]phenyl]ethyl]-7-methyl-10-oxa-7-azabicyclo[4.4.0]deca-2,4,11-triene-3-sulfonamide |
|---|
| Type | Small organic molecule |
|---|
| Emp. Form. | C27H27N5O6S2 |
|---|
| Mol. Mass. | 581.663 |
|---|
| SMILES | CN1CCOc2cc(ccc12)S(=O)(=O)N[C@@H](Cc1ccc(cc1)[C@@H]1CC(=O)NS1(=O)=O)c1nc2ccccc2[nH]1 |r| |
|---|
| Structure | 
|
|---|
Search and Browse
