Reaction Details |
| Report a problem with these data |
Target | Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
---|
Ligand | BDBM13493 |
---|
Substrate/Competitor | BDBM13466 |
---|
Meas. Tech. | Phosphatase Inhibition Assay |
---|
IC50 | 40±n/a nM |
---|
Citation | Ala, PJ; Gonneville, L; Hillman, M; Becker-Pasha, M; Yue, EW; Douty, B; Wayland, B; Polam, P; Crawley, ML; McLaughlin, E; Sparks, RB; Glass, B; Takvorian, A; Combs, AP; Burn, TC; Hollis, GF; Wynn, R Structural insights into the design of nonpeptidic isothiazolidinone-containing inhibitors of protein-tyrosine phosphatase 1B. J Biol Chem281:38013-21 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
---|
Name: | Tyrosine-protein phosphatase non-receptor type 1 [1-298] |
Synonyms: | PTN1_HUMAN | PTP-1B | PTP1B | PTPN1 | PTPase 1B | Protein-Tyrosine Phosphatase 1B (PTP1B) | Tyrosine-protein phosphatase, non-receptor type 1 |
Type: | Enzyme |
Mol. Mass.: | 34670.65 |
Organism: | Homo sapiens (Human) |
Description: | The catalytic domain of PTP 1B (residues 1-298) was expressed and purified from E. coli. |
Residue: | 298 |
Sequence: | MEMEKEFEQIDKSGSWAAIYQDIRHEASDFPCRVAKLPKNKNRNRYRDVSPFDHSRIKLH
QEDNDYINASLIKMEEAQRSYILTQGPLPNTCGHFWEMVWEQKSRGVVMLNRVMEKGSLK
CAQYWPQKEEKEMIFEDTNLKLTLISEDIKSYYTVRQLELENLTTQETREILHFHYTTWP
DFGVPESPASFLNFLFKVRESGSLSPEHGPVVVHCSAGIGRSGTFCLADTCLLLMDKRKD
PSSVDIKKVLLEMRKFRMGLIQTADQLRFSYLAVIEGAKFIMGDSSVQDQWKELSHED
|
|
|
BDBM13493 |
---|
BDBM13466 |
---|
Name | BDBM13493 |
Synonyms: | Isothiazolidinone (IZD) deriv. 29 | N-[(1S)-1-(1H-1,3-benzodiazol-2-yl)-2-[4-(1,1,3-trioxo-1,2-thiazolidin-5-yl)phenyl]ethyl]-4-bromo-3-(trifluoromethyl)benzene-1-sulfonamide |
Type | Small organic molecule |
Emp. Form. | C25H20BrF3N4O5S2 |
Mol. Mass. | 657.479 |
SMILES | FC(F)(F)c1cc(ccc1Br)S(=O)(=O)N[C@@H](Cc1ccc(cc1)C1CC(=O)NS1(=O)=O)c1nc2ccccc2[nH]1 |r| |
Structure |
|