Reaction Details |
| Report a problem with these data |
Target | Tyrosine-protein kinase ABL1 [201-500,E255K] |
---|
Ligand | BDBM4814 |
---|
Substrate/Competitor | BDBM13531 |
---|
Meas. Tech. | Kinase Assay and Binding Constant Measurement |
---|
Kd | >10000±n/a nM |
---|
Citation | Carter, TA; Wodicka, LM; Shah, NP; Velasco, AM; Fabian, MA; Treiber, DK; Milanov, ZV; Atteridge, CE; Biggs, WH; Edeen, PT; Floyd, M; Ford, JM; Grotzfeld, RM; Herrgard, S; Insko, DE; Mehta, SA; Patel, HK; Pao, W; Sawyers, CL; Varmus, H; Zarrinkar, PP; Lockhart, DJ Inhibition of drug-resistant mutants of ABL, KIT, and EGF receptor kinases. Proc Natl Acad Sci U S A102:11011-6 (2005) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Tyrosine-protein kinase ABL1 [201-500,E255K] |
---|
Name: | Tyrosine-protein kinase ABL1 [201-500,E255K] |
Synonyms: | ABL | ABL Mutant (E255K) | ABL1 | ABL1_HUMAN | JTK7 | Proto-oncogene tyrosine-protein kinase ABL1 mutant E255K | c-ABL | p150 |
Type: | Enzyme |
Mol. Mass.: | 34596.83 |
Organism: | Homo sapiens (Human) |
Description: | P00519[201-500,E255K] |
Residue: | 300 |
Sequence: | HHSTVADGLITTLHYPAPKRNKPTVYGVSPNYDKWEMERTDITMKHKLGGGQYGKVYEGV
WKKYSLTVAVKTLKEDTMEVEEFLKEAAVMKEIKHPNLVQLLGVCTREPPFYIITEFMTY
GNLLDYLRECNRQEVNAVVLLYMATQISSAMEYLEKKNFIHRDLAARNCLVGENHLVKVA
DFGLSRLMTGDTYTAHAGAKFPIKWTAPESLAYNKFSIKSDVWAFGVLLWEIATYGMSPY
PGIDLSQVYELLEKDYRMERPEGCPEKVYELMRACWQWNPSDRPSFAEIHQAFETMFQES
|
|
|
BDBM4814 |
---|
BDBM13531 |
---|
Name | BDBM4814 |
Synonyms: | CHEMBL535 | N-[2-(diethylamino)ethyl]-5-[(Z)-(5-fluoro-2-oxo-1,2-dihydro-3H-indol-3-ylidene)methyl]-2,4-dimethyl-1H-pyrrole-3-carboxamide | N-[2-(diethylamino)ethyl]-5-{[(3Z)-5-fluoro-2-oxo-2,3-dihydro-1H-indol-3-ylidene]methyl}-2,4-dimethyl-1H-pyrrole-3-carboxamide | SU11248 | SUNITINIB | SUNITINIB MALATE | US10464902, Sunitinib | US20240058459, Compound Sunit-inib | US9163010, Sunitinib | US9914707, SU11248 |
Type | Small organic molecule |
Emp. Form. | C22H27FN4O2 |
Mol. Mass. | 398.4738 |
SMILES | CCN(CC)CCNC(=O)c1c(C)[nH]c(\C=C2/C(=O)Nc3ccc(F)cc23)c1C |
Structure |
|