Reaction Details |
| Report a problem with these data |
Target | cAMP-specific 3',5'-cyclic phosphodiesterase 7B [91-450] |
---|
Ligand | BDBM14769 |
---|
Substrate/Competitor | BDBM10851 |
---|
Meas. Tech. | Phosphodiesterase (PDE) Inhibition Assay |
---|
IC50 | >200000±n/a nM |
---|
Citation | Card, GL; England, BP; Suzuki, Y; Fong, D; Powell, B; Lee, B; Luu, C; Tabrizizad, M; Gillette, S; Ibrahim, PN; Artis, DR; Bollag, G; Milburn, MV; Kim, SH; Schlessinger, J; Zhang, KY Structural basis for the activity of drugs that inhibit phosphodiesterases. Structure12:2233-47 (2004) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
cAMP-specific 3',5'-cyclic phosphodiesterase 7B [91-450] |
---|
Name: | cAMP-specific 3',5'-cyclic phosphodiesterase 7B [91-450] |
Synonyms: | PDE7B | PDE7B_HUMAN | Phosphodiesterase Type 7 (PDE7B) | cAMP-specific 3,5-cyclic phosphodiesterase 7B |
Type: | Enzyme Catalytic Domain |
Mol. Mass.: | 41494.16 |
Organism: | Homo sapiens (Human) |
Description: | Recombinant catalytic domain (Q91-P450) of human PDE7B. |
Residue: | 360 |
Sequence: | QAPLHLLDEDYLGQARHMLSKVGMWDFDIFLFDRLTNGNSLVTLLCHLFNTHGLIHHFKL
DMVTLHRFLVMVQEDYHSQNPYHNAVHAADVTQAMHCYLKEPKLASFLTPLDIMLGLLAA
AAHDVDHPGVNQPFLIKTNHHLANLYQNMSVLENHHWRSTIGMLRESRLLAHLPKEMTQD
IEQQLGSLILATDINRQNEFLTRLKAHLHNKDLRLEDAQDRHFMLQIALKCADICNPCRI
WEMSKQWSERVCEEFYRQGELEQKFELEISPLCNQQKDSIPSIQIGFMSYIVEPLFREWA
HFTGNSTLSENMLGHLAHNKAQWKSLLPRQHRSRGSSGSGPDHDHAGQGTESEEQEGDSP
|
|
|
BDBM14769 |
---|
BDBM10851 |
---|
Name | BDBM14769 |
Synonyms: | 6-(3,4-Dimethoxy-phenyl)-4,5-dimethyl-4,5-dihydro-2H-pyridazin-3-one | 6-(4-(difluoromethoxy)-3-methoxyphenyl)pyridazin-3(2H)-one | 6-(4-Difluoromethoxy-3-methoxy-phenyl)-2H-pyridazin-3-one | 6-[4-(difluoromethoxy)-3-methoxyphenyl]-2,3-dihydropyridazin-3-one | CHEMBL313842 | Zaradaverine | Zardaverine |
Type | Small organic molecule |
Emp. Form. | C12H10F2N2O3 |
Mol. Mass. | 268.2162 |
SMILES | COc1cc(ccc1OC(F)F)-c1ccc(=O)[nH]n1 |
Structure |
|