Reaction Details |
| Report a problem with these data |
Target | RAC-alpha serine/threonine-protein kinase [139-480,S378A,S381A,T450D,S473D] |
---|
Ligand | BDBM15137 |
---|
Substrate/Competitor | biotinylated Akt peptide substrate |
---|
Meas. Tech. | Akt Kinase Assay |
---|
pH | 7.5±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 185±n/a nM |
---|
Citation | Thomas, SA; Li, T; Woods, KW; Song, X; Packard, G; Fischer, JP; Diebold, RB; Liu, X; Shi, Y; Klinghofer, V; Johnson, EF; Bouska, JJ; Olson, A; Guan, R; Magnone, SR; Marsh, K; Luo, Y; Rosenberg, SH; Giranda, VL; Li, Q Identification of a novel 3,5-disubstituted pyridine as a potent, selective, and orally active inhibitor of Akt1 kinase. Bioorg Med Chem Lett16:3740-4 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
RAC-alpha serine/threonine-protein kinase [139-480,S378A,S381A,T450D,S473D] |
---|
Name: | RAC-alpha serine/threonine-protein kinase [139-480,S378A,S381A,T450D,S473D] |
Synonyms: | AKT1 | AKT1_HUMAN | C-AKT | PKB | Protein kinase B (Akt 1) | Protein kinase B alpha | RAC | RAC-PK-alpha |
Type: | Enzyme |
Mol. Mass.: | 39513.28 |
Organism: | Homo sapiens (Human) |
Description: | Recombinant His-tagged Akt1 (S378A, S381A, T450D,
S473D; 139-480) |
Residue: | 342 |
Sequence: | AKPKHRVTMNEFEYLKLLGKGTFGKVILVKEKATGRYYAMKILKKEVIVAKDEVAHTLTE
NRVLQNSRHPFLTALKYSFQTHDRLCFVMEYANGGELFFHLSRERVFSEDRARFYGAEIV
SALDYLHSEKNVVYRDLKLENLMLDKDGHIKITDFGLCKEGIKDGATMKTFCGTPEYLAP
EVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHEKLFELILMEEIRFPRTLGPEAKA
LLAGLLKKDPKQRLGGGSEDAKEIMQHRFFAGIVWQHVYEKKLSPPFKPQVTSETDTRYF
DEEFTAQMITIDPPDQDDSMECVDSERRPHFPQFDYSASGTA
|
|
|
BDBM15137 |
---|
biotinylated Akt peptide substrate |
---|
Name: | biotinylated Akt peptide substrate |
Synonyms: | n/a |
Type: | Biotinylated Peptide |
Mol. Mass.: | 3178.04 |
Organism: | n/a |
Description: | Km=15 uM |
Residue: | 28 |
Sequence: | biotin-Ahx-EELSPFRGRSRSAPPNLWAAQR
|
|
|