Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetFibroblast growth factor receptor
LigandBDBM350051
Substrate/Competitorn/a
Meas. Tech.Enzyme Assay
IC50 1.80±n/a nM
Citation Andrews SWBlake JFCook AGunawardana IWHunt KWMetcalf ATMoreno DRen LTang TP 2-aryl- and 2-heteroaryl-substituted 2-pyridazin-3(2H)-one compounds as inhibitors of FGFR tyrosine kinases US Patent  US10208024 Publication Date 2/19/2019
More Info.:Get all data from this article,  Assay Method
 
Fibroblast growth factor receptor
Name:Fibroblast growth factor receptor
Synonyms:CD_antigen: CD333 | FGFR-3 | FGFR3 | Fibroblast growth factor receptor 3 (FGFR3) | JTK4
Type:Protein
Mol. Mass.:87699.57
Organism:Homo sapiens (Human)
Description:P22607
Residue:806
Sequence:
MGAPACALALCVAVAIVAGASSESLGTEQRVVGRAAEVPGPEPGQQEQLVFGSGDAVELS
CPPPGGGPMGPTVWVKDGTGLVPSERVLVGPQRLQVLNASHEDSGAYSCRQRLTQRVLCH
FSVRVTDAPSSGDDEDGEDEAEDTGVDTGAPYWTRPERMDKKLLAVPAANTVRFRCPAAG
NPTPSISWLKNGREFRGEHRIGGIKLRHQQWSLVMESVVPSDRGNYTCVVENKFGSIRQT
YTLDVLERSPHRPILQAGLPANQTAVLGSDVEFHCKVYSDAQPHIQWLKHVEVNGSKVGP
DGTPYVTVLKTAGANTTDKELEVLSLHNVTFEDAGEYTCLAGNSIGFSHHSAWLVVLPAE
EELVEADEAGSVYAGILSYGVGFFLFILVVAAVTLCRLRSPPKKGLGSPTVHKISRFPLK
RQVSLESNASMSSNTPLVRIARLSSGEGPTLANVSELELPADPKWELSRARLTLGKPLGE
GCFGQVVMAEAIGIDKDRAAKPVTVAVKMLKDDATDKDLSDLVSEMEMMKMIGKHKNIIN
LLGACTQGGPLYVLVEYAAKGNLREFLRARRPPGLDYSFDTCKPPEEQLTFKDLVSCAYQ
VARGMEYLASQKCIHRDLAARNVLVTEDNVMKIADFGLARDVHNLDYYKKTTNGRLPVKW
MAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIPVEELFKLLKEGHRMDKPANCT
HDLYMIMRECWHAAPSQRPTFKQLVEDLDRVLTVTSTDEYLDLSAPFEQYSPGGQDTPSS
SSSGDDSVFAHDLLPPAPPSSGGSRT
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM350051
n/a
NameBDBM350051
Synonyms:US10208024, Example 50
TypeSmall organic molecule
Emp. Form.C25H28N8O3
Mol. Mass.488.5416
SMILESCOc1cc(OC)cc(c1)-n1nc(cc(C)c1=O)-c1nc(cnc1N)-c1cnn(c1)C1CCNCC1
Structure
Search PDB for entries with ligand similarity:Similarity to this molecule at least: