Reaction Details |
| Report a problem with these data |
Target | Mitogen-activated protein kinase 14 |
---|
Ligand | BDBM16528 |
---|
Substrate/Competitor | biotinylated GST-ATF2 |
---|
Meas. Tech. | Enzyme Inhibition Scintillation Proximity Assay |
---|
pH | 7±n/a |
---|
Temperature | 303.15±n/a K |
---|
IC50 | 11±n/a nM |
---|
Citation | Natarajan, SR; Heller, ST; Nam, K; Singh, SB; Scapin, G; Patel, S; Thompson, JE; Fitzgerald, CE; O'Keefe, SJ p38 MAP kinase inhibitors. Part 6: 2-arylpyridazin-3-ones as templates for inhibitor design. Bioorg Med Chem Lett16:5809-13 (2006) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Mitogen-activated protein kinase 14 |
---|
Name: | Mitogen-activated protein kinase 14 |
Synonyms: | Crk1 | Csbp1 | Csbp2 | MAP Kinase p38 alpha | MAP kinase p38 | MK14_MOUSE | Mapk14 | Mitogen-activated protein kinase 14 | Mitogen-activated protein kinase p38 alpha |
Type: | Enzyme |
Mol. Mass.: | 41281.22 |
Organism: | Mus musculus (mouse) |
Description: | The full-length open reading frame of murine p38 alpha was cloned and expressed in E. coli.. Soluble murine p38R was extracted from cell pellets and purified using ion-exchange chromatography. |
Residue: | 360 |
Sequence: | MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGHRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHIDQLKLILRLVG
TPGAELLKKISSESARNYIQSLAQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVISFVPPPLDQEEMES
|
|
|
BDBM16528 |
---|
biotinylated GST-ATF2 |
---|
Name: | biotinylated GST-ATF2 |
Synonyms: | ATF-2-GST | ATF2 | Activating transcription factor 2 | Activating transcription factor 2-GST fusion | GST-ATF2 | biotinylated ATF2 substrate | biotinylated activating transcription factor 2 |
Type: | Other Protein Type |
Mol. Mass.: | 12237.77 |
Organism: | Homo sapiens (Human) |
Description: | n/a |
Residue: | 109 |
Sequence: | MSDDKPFLCTAPGCGQRFTNEDHLAVHKHKHEMTLKFGPARNDSVIVADQTPTPTRFLKN
CEEVGLFNELASPFENEFKKASEDDIKKMPLDLSPLATPIIRSKIEEPS
|
|
|