Ki Summary new BindingDB logo
myBDB logout
Reaction Details
Report a problem with these data
TargetcAMP-Dependent Protein Kinase (PKA)
LigandBDBM16588
Substrate/Competitorbiotinylated kemptide
Meas. Tech.PKA/PKC Kinase Assay
IC50 7±n/a nM
Citation Zhu GDGandhi VBGong JThomas SWoods KWSong XLi TDiebold RBLuo YLiu XGuan RKlinghofer VJohnson EFBouska JOlson AMarsh KCStoll VSMamo MPolakowski JCampbell TJMartin RLGintant GAPenning TDLi QRosenberg SHGiranda VL Syntheses of potent, selective, and orally bioavailable indazole-pyridine series of protein kinase b/akt inhibitors with reduced hypotension. J Med Chem 50:2990-3003 (2007) [PubMed]  Article
More Info.:Get all data from this article,   Solution Info,  Assay Method
 
cAMP-Dependent Protein Kinase (PKA)
Name:cAMP-dependent protein kinase A
Synonyms:PKA C-alpha | PKC | Protein Kinase C | Protein Kinase C, bovine brain | cAMP-dependent Protein Kinase, bovine heart | cAMP-dependent protein kinase A | cAMP-dependent protein kinase alpha-catalytic subunit | cAMP-dependent protein kinase, alpha-catalytic subunit
Type:Enzyme Complex
Mol. Mass.:40627.77
Organism:Bos taurus (bovine)
Description:The PKA holoenzyme purified from bovine heart, exists as an inactive tetrameric complex, which consists of a regulatory dimer associated with two catalytic subunits. It requires cAMP to activate the enzymatic reaction.
Residue:351
Sequence:
MGNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVML
VKHMETGNHYAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEFSFKDNSNLYMV
MEYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGY
IQVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFF
ADQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKNGVNDIKNHKWFAT
TDWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
Blast this sequence in BindingDB or PDB
  Blast E-value cutoff:
BDBM16588
biotinylated kemptide
Name:biotinylated kemptide
Synonyms:n/a
Type:Biotinylated Peptide
Mol. Mass.:1353.09
Organism:n/a
Description:n/a
Residue:12
Sequence:
biotin-hx-LRRASLG