Reaction Details |
| Report a problem with these data |
Target | Serine protease 1 |
---|
Ligand | BDBM18982 |
---|
Substrate/Competitor | BDBM12658 |
---|
Meas. Tech. | Enzyme Assay and Determination of the Inhibition Constants. |
---|
pH | 7±n/a |
---|
Temperature | 295.15±n/a K |
---|
Ki | 2600±n/a nM |
---|
Citation | Lam, PY; Clark, CG; Li, R; Pinto, DJ; Orwat, MJ; Galemmo, RA; Fevig, JM; Teleha, CA; Alexander, RS; Smallwood, AM; Rossi, KA; Wright, MR; Bai, SA; He, K; Luettgen, JM; Wong, PC; Knabb, RM; Wexler, RR Structure-based design of novel guanidine/benzamidine mimics: potent and orally bioavailable factor Xa inhibitors as novel anticoagulants. J Med Chem46:4405-18 (2003) [PubMed] Article |
---|
More Info.: | Get all data from this article, Solution Info, Assay Method |
---|
|
Serine protease 1 |
---|
Name: | Serine protease 1 |
Synonyms: | Beta-Trypsin | Cationic trypsin | PRSS1 | TRP1 | TRY1 | TRY1_BOVIN | TRYP1 | Trypsin | Trypsin I |
Type: | Enzyme |
Mol. Mass.: | 25790.52 |
Organism: | Bos taurus (bovine) |
Description: | P00760 |
Residue: | 246 |
Sequence: | MKTFIFLALLGAAVAFPVDDDDKIVGGYTCGANTVPYQVSLNSGYHFCGGSLINSQWVVS
AAHCYKSGIQVRLGEDNINVVEGNEQFISASKSIVHPSYNSNTLNNDIMLIKLKSAASLN
SRVASISLPTSCASAGTQCLISGWGNTKSSGTSYPDVLKCLKAPILSDSSCKSAYPGQIT
SNMFCAGYLEGGKDSCQGDSGGPVVCSGKLQGIVSWGSGCAQKNKPGVYTKVCNYVSWIK
QTIASN
|
|
|
BDBM18982 |
---|
BDBM12658 |
---|
Name | BDBM18982 |
Synonyms: | 1-(1-aminoisoquinolin-7-yl)-3-methyl-N-[4-(2-sulfamoylphenyl)phenyl]-1H-pyrazole-5-carboxamide | SQ-311 | pyrazole-based inhibitor, 24a |
Type | Small organic molecule |
Emp. Form. | C26H22N6O3S |
Mol. Mass. | 498.556 |
SMILES | Cc1cc(C(=O)Nc2ccc(cc2)-c2ccccc2S(N)(=O)=O)n(n1)-c1ccc2ccnc(N)c2c1 |
Structure |
|